CoraLite® Plus 488-conjugated MPO Monoclonal antibody CL488-66177 proteintech
$479.00
In stock
SKU
CL488-66177
| Catalog Number | CL488-66177 |
| Synonyms | 4C11F6, EC:1.11.2.2, myeloperoxidase |
| Host | Mouse |
| Reactivity | human, rat |
| Form | Liquid |
| Formulation | PBS, Proclin300, BSA, Glycerol |
| Applications | IF-P, FC (Intra) |
| Host / Isotype | Mouse / IgA |
| Tested Applications — Positive IF-P detected in | human tonsillitis tissue |
| Tested Applications — Positive FC (Intra) detected in | HL-60 cells |
| Recommended Dilutions — Immunofluorescence (IF)-P | IF-P : 1:50-1:500 |
| Recommended Dilutions — Flow Cytometry (FC) (INTRA) | FC (INTRA) : 0.80 ug per 10^6 cells in a 100 µl suspension |
| Positive IF-P detected in | human tonsillitis tissue |
| Positive FC (Intra) detected in | HL-60 cells |
| Immunofluorescence (IF)-P | IF-P : 1:50-1:500 |
| Flow Cytometry (FC) (INTRA) | FC (INTRA) : 0.80 ug per 10^6 cells in a 100 µl suspension |
| Tested Reactivity | human, rat |
| Cited Reactivity | human |
| Class | Monoclonal |
| Type | Antibody |
| Immunogen | CatNo: Ag17564 Product name: Recombinant human MPO protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 606-657 aa of BC130476 Sequence: CGLPQPETVGQLGTVLRNLKLARKLMEQYGTPNNIDIWMGGVSEPLKRKGRV Predict reactive species |
| Full Name | myeloperoxidase |
| Calculated Molecular Weight | 745 aa, 84 kDa |
| Observed Molecular Weight | 90 kDa |
| GenBank Accession Number | BC130476 |
| Gene Symbol | MPO |
| Gene ID (NCBI) | 4353 |
| RRID | AB_2919295 |
| Conjugate | CoraLite® Plus 488 Fluorescent Dye |
| Excitation/Emission Maxima Wavelengths | 493 nm / 522 nm |
| Excitation Laser | Blue laser (488 nm) |
| Purification Method | Thiophilic affinity chromatograph |
| UNIPROT ID | P05164 |
| Storage Buffer | PBS with 50% glycerol, 0.05% Proclin300, 0.5% BSA, pH 7.3. |
| Storage Conditions | Store at -20°C. Avoid exposure to light. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. |
| FC protocol for CL Plus 488 MPO antibody CL488-66177 | Download protocol |
| IF protocol for CL Plus 488 MPO antibody CL488-66177 | Download protocol |
| human | IF Sci Rep Exploring the dual role of extracellular vesicles in coagulation and immune modulation in glioblastoma. Authors - Annabell Wolff View Article |
| Sonja (Verified Customer) (08-04-2023) | The antibody works absolutely perfect in human FFPE tissue. The fluorescence intensity was very strong. Applications: Immunohistochemistry, Immunofluorescence Primary Antibody Dilution: 1:100 Cell Tissue Type: FFPE Human Tonsil CL Plus 488 MPO Antibody Immunohistochemistry,Immunofluorescence validation (1:100 dilution) in FFPE Human Tonsil (Cat no:CL488-66177) |
| Citations | 3 |
| Dilutions | IF-P : 1:50-1:500 FC (INTRA) : 0.80 ug per 10^6 cells in a 100 µl suspension |
| Isotype | IgA |
| Clonality | Monoclonal |
| Clone Number | 4C11F6 |
| Conjugation | CoraLite® Plus 488 |
The MPO gene encodes myeloperoxidase, a lysosomal hemoprotein located in the azurophilic granules of polymorphonuclear (PMN) leukocytes and monocytes. In response to stimulation, MPO is activated into a transient intermediate with potent antimicrobial oxidizing abilities(PMID:17650507). The mRNA is translated into a single protein of 90 kDa, which displays enzymatic activity and undergoes proteolytic maturation into a heavy chain of 59 kDa and a light chain of 13.5 kDa; these subunits then dimerize into the mature tetramer and the mature MPO is a heterotetramer composed of two identical heavy chains and two identical light chains(PMID:12773517). The 24-kDa material had a map identical to that of 13.5 kDa subunit and represents a dimer of the 13.5 kDa subunit (PMID:3008892). Defects in MPO are the cause of myeloperoxidase deficiency (MPOD). It has 3 isoforms produced by alternative splicing. Protocols Product Specific Protocols FC protocol for CL Plus 488 MPO antibody CL488-66177 Download protocol IF protocol for CL Plus 488 MPO antibody CL488-66177 Download protocol Standard Protocols Click here to view our Standard Protocols
Publications
- Polystyrene nanoplastics exacerbate systemic lupus erythematosus via neutrophil extracellular traps (NETs) formation.
Journal: Environ Pollut | Authors: Wanlan Jiang - Exploring the dual role of extracellular vesicles in coagulation and immune modulation in glioblastoma.
Journal: Sci Rep | Authors: Annabell Wolff | Species: human | Application: IF - Borneol Alleviates Polyethylene Microsphere-Induced Cerebral Microcirculatory Dysfunction with Reduced NET-Related Markers.
Journal: Brain Sci | Authors: Yanlong Zhou
Reviews
Write Your Own Review
Related Products
Check items to add to the cart or
