MRPS25 Polyclonal antibody 15277-1-AP proteintech
$149.00
In stock
SKU
15277-1-AP
| Catalog Number | 15277-1-AP |
| Synonyms | Small ribosomal subunit protein mS25, S25mt, RPMS25, MRP-S25, MRP S25 |
| Host | Rabbit |
| Reactivity | human, mouse, rat |
| Form | Liquid |
| Formulation | PBS, Azide, Glycerol |
| Applications | WB, IHC, IP, ELISA |
| Host / Isotype | Rabbit / IgG |
| Tested Applications — Positive WB detected in | HEK-293 cells, HepG2 cells |
| Tested Applications — Positive IP detected in | HEK-293 cells |
| Tested Applications — Positive IHC detected in | human intrahepatic cholangiocarcinoma tissue, human stomach tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
| Recommended Dilutions — Western Blot (WB) | WB : 1:500-1:2000 |
| Recommended Dilutions — Immunoprecipitation (IP) | IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate |
| Recommended Dilutions — Immunohistochemistry (IHC) | IHC : 1:50-1:500 |
| Positive WB detected in | HEK-293 cells, HepG2 cells |
| Positive IP detected in | HEK-293 cells |
| Positive IHC detected in | human intrahepatic cholangiocarcinoma tissue, human stomach tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
| Western Blot (WB) | WB : 1:500-1:2000 |
| Immunoprecipitation (IP) | IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate |
| Immunohistochemistry (IHC) | IHC : 1:50-1:500 |
| Tested Reactivity | human, mouse, rat |
| Cited Reactivity | human, mouse |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen | CatNo: Ag7395 Product name: Recombinant human MRPS25 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-173 aa of BC003590 Sequence: MPMKGRFPIRRTLQYLSQGNVVFKDSVKVMTVNYNTHGELGEGARKFVFFNIPQIQYKNPWVQIMMFKNMTPSPFLRFYLDSGEQVLVDVETKSNKEIMEHIRKILGKNEETLREEEEEKKQLSHPANFGPRKYCLRECICEVEGQVPCPSLVPLPKEMRGKYKAALKADAQD Predict reactive species |
| Full Name | mitochondrial ribosomal protein S25 |
| Calculated Molecular Weight | 20 kDa |
| Observed Molecular Weight | 20 kDa |
| GenBank Accession Number | BC003590 |
| Gene Symbol | MRPS25 |
| Gene ID (NCBI) | 64432 |
| RRID | AB_2180358 |
| Conjugate | Unconjugated |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | P82663 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA. |
| IHC protocol for MRPS25 antibody 15277-1-AP | Download protocol |
| IP protocol for MRPS25 antibody 15277-1-AP | Download protocol |
| WB protocol for MRPS25 antibody 15277-1-AP | Download protocol |
| mouse | WB Methods Mol Biol Linear Density Sucrose Gradients to Study Mitoribosomal Biogenesis in Tissue-Specific Knockout Mice. Authors - Benedetta Ruzzenente View Article |
| human | WB,IP Nucleic Acids Res BOLA3 and NFU1 link mitoribosome iron-sulfur cluster assembly to multiple mitochondrial dysfunctions syndrome Authors - Hui Zhong View Article |
| Citations | 7 |
| Dilutions | WB : 1:500-1:2000 IP : 0.5-4.0 ug for IP and 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate for WB IHC : 1:50-1:500 |
| Isotype | IgG |
| Clonality | Polyclonal |
| Clone Number | - |
| Conjugation | Unconjugated |
Mitochondrial ribosomal protein S25 (MRPS25) belongs to the ribosomal protein S25/L51 family. It is a component of the mitochondrial ribosome small subunit (28S). The variant segregated with the disease and substitutes a highly conserved proline residue with leucine (p.P72L) that, based on the high-resolution structure of the 28S ribosome, is predicted to compromise inter-protein contacts and destabilize the small subunit. Protocols Product Specific Protocols IHC protocol for MRPS25 antibody 15277-1-AP Download protocol IP protocol for MRPS25 antibody 15277-1-AP Download protocol WB protocol for MRPS25 antibody 15277-1-AP Download protocol Standard Protocols Click here to view our Standard Protocols
Publications
- Mutation in MRPS34 Compromises Protein Synthesis and Causes Mitochondrial Dysfunction.
Journal: PLoS Genet | Authors: Tara R Richman | Species: mouse | Application: WB - Supernumerary proteins of the human mitochondrial ribosomal small subunit are integral for assembly and translation
Journal: iScience | Authors: Taru Hilander | Species: human | Application: WB - Human ERAL1 is a mitochondrial RNA chaperone involved in the assembly of the 28S small mitochondrial ribosomal subunit.
Journal: Biochem J | Authors: Dennerlein Sven S | Species: human | Application: WB - Linear Density Sucrose Gradients to Study Mitoribosomal Biogenesis in Tissue-Specific Knockout Mice.
Journal: Methods Mol Biol | Authors: Benedetta Ruzzenente | Species: mouse | Application: WB - Mutations in mitochondrial ribosomal protein MRPL12 leads to growth retardation, neurological deterioration and mitochondrial translation deficiency.
Journal: Biochim Biophys Acta | Authors: Serre Valérie V | Species: human | Application: WB - BOLA3 and NFU1 link mitoribosome iron-sulfur cluster assembly to multiple mitochondrial dysfunctions syndrome
Journal: Nucleic Acids Res | Authors: Hui Zhong | Species: human | Application: WB,IP
Reviews
Write Your Own Review
Related Products
Check items to add to the cart or
