MSI1 Recombinant monoclonal antibody, PBS Only (Capture) 86723-1-PBS proteintech
$699.00
In stock
SKU
86723-1-PBS
| Catalog Number | 86723-1-PBS |
| Synonyms | Musashi 1, musashi homolog 1 (Drosophila), Musashi-1, RNA-binding protein Musashi homolog 1 |
| Host | Rabbit |
| Reactivity | human, mouse, rat |
| Form | Liquid |
| Formulation | PBS Only |
| Applications | WB, IHC, IF/ICC, Cytometric bead array, Indirect ELISA |
| Host / Isotype | Rabbit / IgG |
| Tested Reactivity | human, mouse, rat |
| Class | Recombinant |
| Type | Antibody |
| Immunogen | CatNo: Ag26042 Product name: Recombinant human MSI1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-83 aa of BC146463 Sequence: METDAPQPGLASPDSPHDPCKMFIGGLSWQTTQEGLREYFGQFGEVKECLVMRDPLTKRSRGFGFVTFMDQAGVDKVLAQSRH Predict reactive species |
| Full Name | musashi homolog 1 (Drosophila) |
| Calculated Molecular Weight | 362 aa, 39 kDa |
| Observed Molecular Weight | 37-40 kDa |
| GenBank Accession Number | BC146463 |
| Gene Symbol | MSI1 |
| Gene ID (NCBI) | 4440 |
| RRID | AB_3745079 |
| Conjugate | Unconjugated |
| Purification Method | Protein A purification |
| UNIPROT ID | O43347 |
| Storage Buffer | PBS only, pH 7.3. |
| Storage Conditions | Store at -80°C. |
| Citations | - |
| Isotype | IgG |
| Clonality | Recombinant |
| Clone Number | 251695G8 |
| Conjugation | Unconjugated |
Musashi1 (Msi1) is an RNA-binding protein expressed in neural progenitor cells and neural stem cells. The gene encoding human Msi1 encodes a 362 amino acid protein. In murine embryonic neural progenitor cells, Msi1 localizes to the cytoplasm and is downregulated during differentiation. Msi1 binds to NUMB, which encodes a membrane-associated antagonist of Notch signaling. Msi1 appears to function in the proliferation and maintenance of stem cell populations of the central nervous system. In addition to its usefulness as a marker for neural progenitor cells in normal human brains, Msi1 is also a marker for human gliomas. In rats, Msi1 is expressed in Sertoli cells of the testis and granulosa cells of the ovary.
Reviews
Write Your Own Review
Related Products
Check items to add to the cart or
