MTHFD1 Polyclonal antibody 10794-1-AP proteintech
$149.00
In stock
SKU
10794-1-AP
| Catalog Number | 10794-1-AP |
| Synonyms | C-1-tetrahydrofolate synthase, cytoplasmic, C-1-tetrahydrofolate synthase, cytoplasmic, N-terminally processed, C1-THF synthase, Epididymis secretory sperm binding protein, MTHFC |
| Host | Rabbit |
| Reactivity | human, mouse |
| Form | Liquid |
| Formulation | PBS, Azide, Glycerol |
| Applications | WB, IHC, IF/ICC, IP, ELISA |
| Host / Isotype | Rabbit / IgG |
| Tested Applications — Positive WB detected in | HEK-293 cells, HuH-7 cells, human brain tissue, K-562 cells, mouse kidney tissue, MCF-7 cells |
| Tested Applications — Positive IP detected in | mouse kidney tissue |
| Tested Applications — Positive IHC detected in | human liver cancer tissue, human colon cancer tissue, mouse liver tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
| Tested Applications — Positive IF/ICC detected in | HEK-293 cells |
| Recommended Dilutions — Western Blot (WB) | WB : 1:2000-1:10000 |
| Recommended Dilutions — Immunoprecipitation (IP) | IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate |
| Recommended Dilutions — Immunohistochemistry (IHC) | IHC : 1:200-1:2000 |
| Recommended Dilutions — Immunofluorescence (IF)/ICC | IF/ICC : 1:200-1:800 |
| Positive WB detected in | HEK-293 cells, HuH-7 cells, human brain tissue, K-562 cells, mouse kidney tissue, MCF-7 cells |
| Positive IP detected in | mouse kidney tissue |
| Positive IHC detected in | human liver cancer tissue, human colon cancer tissue, mouse liver tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
| Positive IF/ICC detected in | HEK-293 cells |
| Western Blot (WB) | WB : 1:2000-1:10000 |
| Immunoprecipitation (IP) | IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate |
| Immunohistochemistry (IHC) | IHC : 1:200-1:2000 |
| Immunofluorescence (IF)/ICC | IF/ICC : 1:200-1:800 |
| Tested Reactivity | human, mouse |
| Cited Reactivity | human, mouse |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen | CatNo: Ag1225 Product name: Recombinant human MTHFD1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 536-935 aa of BC009806 Sequence: TNDRFLRKITIGQAPTEKGHTRTAQFDISVASEIMAVLALTTSLEDMRERLGKMVVASSKKGEPVSAEDLGVSGALTVLMKDAIKPNLMQTLEGTPVFVHAGPFANIAHGNSSIIADQIALKLVGPEGFVVTEAGFGADIGMEKFFNIKCRYSGLCPHVVVLVATVRALKMHGGGPTVTAGLPLPKAYIQENLELVEKGFSNLKKQIENARMFGIPVVVAVNAFKTDTESELDLISRLSREHGAFDAVKCTHWAEGGKGALALAQAVQRAAQAPSSFQLLYDLKLPVEDKIRIIAQKIYGADDIELLPEAQHKAEVYTKQGFGNLPICMAKTHLSLSHNPEQKGVPTGFILPIRDIRASVGAGFLYPLVGTMSTMPGLPTRPCFYDIDLDPETEQVNGLF Predict reactive species |
| Full Name | methylenetetrahydrofolate dehydrogenase (NADP+ dependent) 1, methenyltetrahydrofolate cyclohydrolase, formyltetrahydrofolate synthetase |
| Calculated Molecular Weight | 101 kDa |
| Observed Molecular Weight | 101 kDa |
| GenBank Accession Number | BC009806 |
| Gene Symbol | MTHFD1 |
| Gene ID (NCBI) | 4522 |
| RRID | AB_2147391 |
| Conjugate | Unconjugated |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | P11586 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA. |
| IF protocol for MTHFD1 antibody 10794-1-AP | Download protocol |
| IHC protocol for MTHFD1 antibody 10794-1-AP | Download protocol |
| IP protocol for MTHFD1 antibody 10794-1-AP | Download protocol |
| WB protocol for MTHFD1 antibody 10794-1-AP | Download protocol |
| human | WB Cell Death Dis MTHFD1 regulates the NADPH redox homeostasis in MYCN-amplified neuroblastoma Authors - Jinqiu Guan View Article |
| mouse | WB Dev Cell Illuminating NAD+ Metabolism in Live Cells and In Vivo Using a Genetically Encoded Fluorescent Sensor. Authors - Yejun Zou View Article |
| Lili (Verified Customer) (02-05-2026) | Great antibody. Works amazing, no background binding. Applications: Western Blot Primary Antibody Dilution: 1:1000 Cell Tissue Type: Human cell lines MTHFD1 Antibody Western Blot validation (1:1000 dilution) in Human cell lines (Cat no:10794-1-AP) |
| Hua (Verified Customer) (08-26-2019) | Works well. Applications: Western Blot, Primary Antibody Dilution: 1:500 Cell Tissue Type: liver, kidney, Hippocampus MTHFD1 Antibody Western Blot, validation (1:500 dilution) in liver, kidney, Hippocampus (Cat no:10794-1-AP) |
| Citations | 20 |
| Dilutions | WB : 1:2000-1:10000 IP : 0.5-4.0 ug for IP and 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate for WB IHC : 1:200-1:2000 IF/ICC : 1:200-1:800 |
| Isotype | IgG |
| Clonality | Polyclonal |
| Clone Number | - |
| Conjugation | Unconjugated |
MTHFD1 is a trifunctional enzyme involved in the pathway tetrahydrofolate interconversion, which is part of One-carbon metabolism. MTHFD1 is associated with HCC and CRC progression. It has been reported that MTHFD-deficient patient fibroblasts exhibit enriched MTHFD1 in the nucleus which is critical for de novo dTMP synthesis.(PMID: 31133746, 30997850, 31421459, 25548164) Protocols Product Specific Protocols IF protocol for MTHFD1 antibody 10794-1-AP Download protocol IHC protocol for MTHFD1 antibody 10794-1-AP Download protocol IP protocol for MTHFD1 antibody 10794-1-AP Download protocol WB protocol for MTHFD1 antibody 10794-1-AP Download protocol Standard Protocols Click here to view our Standard Protocols
Publications
- Oxidative stress inhibits distant metastasis by human melanoma cells.
Journal: Nature | Authors: Elena Piskounova KD Validated | Species: human | Application: WB - Melatonin modulates metabolic remodeling in HNSCC by suppressing MTHFD1L-formate axis.
Journal: J Pineal Res | Authors: Li Cui | Species: human | Application: WB - Cytosolic ME1 integrated with mitochondrial IDH2 supports tumor growth and metastasis.
Journal: Redox Biol | Authors: Chang Shao | Species: human | Application: WB - Orthogonal genome-wide screens of bat cells identify MTHFD1 as a target of broad antiviral therapy.
Journal: Proc Natl Acad Sci U S A | Authors: Danielle E Anderson KD Validated | Species: human | Application: WB - Illuminating NAD+ Metabolism in Live Cells and In Vivo Using a Genetically Encoded Fluorescent Sensor.
Journal: Dev Cell | Authors: Yejun Zou | Species: mouse | Application: WB - MTHFD1 regulates the NADPH redox homeostasis in MYCN-amplified neuroblastoma
Journal: Cell Death Dis | Authors: Jinqiu Guan | Species: human | Application: WB
Reviews
Write Your Own Review
Related Products
Check items to add to the cart or
