MYCBP Recombinant monoclonal antibody 85891-1-RR proteintech
$149.00
In stock
SKU
85891-1-RR
| Catalog Number | 85891-1-RR |
| Synonyms | AMY 1, AMY1, AMY-1, Associate of Myc 1, c-Myc-binding protein |
| Host | Rabbit |
| Reactivity | human |
| Form | Liquid |
| Formulation | PBS, Azide, Glycerol |
| Applications | WB, IF/ICC, ELISA |
| Host / Isotype | Rabbit / IgG |
| Tested Applications — Positive WB detected in | HeLa cells, A549 cells, HEK-293 cells, Jurkat cells |
| Tested Applications — Positive IF/ICC detected in | HEK-293T cells |
| Recommended Dilutions — Western Blot (WB) | WB : 1:500-1:2000 |
| Recommended Dilutions — Immunofluorescence (IF)/ICC | IF/ICC : 1:50-1:500 |
| Positive WB detected in | HeLa cells, A549 cells, HEK-293 cells, Jurkat cells |
| Positive IF/ICC detected in | HEK-293T cells |
| Western Blot (WB) | WB : 1:500-1:2000 |
| Immunofluorescence (IF)/ICC | IF/ICC : 1:50-1:500 |
| Tested Reactivity | human |
| Class | Recombinant |
| Type | Antibody |
| Immunogen | CatNo: Ag2651 Product name: Recombinant human MYCBP protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-103 aa of BC008686 Sequence: MAHYKAADSKREQFRRYLEKSGVLDTLTKVLVALYEEPEKPNSALDFLKHHLGAATPENPEIELLRLELAEMKEKYEAIVEENKKLKAKLAQYEPPQEEKRAE Predict reactive species |
| Full Name | c-myc binding protein |
| Calculated Molecular Weight | 103 aa, 12 kDa |
| Observed Molecular Weight | 12 kDa |
| GenBank Accession Number | BC008686 |
| Gene Symbol | MYCBP |
| Gene ID (NCBI) | 26292 |
| RRID | AB_3744450 |
| Conjugate | Unconjugated |
| Purification Method | Protein A purification |
| UNIPROT ID | Q99417 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA. |
| IF protocol for MYCBP antibody 85891-1-RR | Download protocol |
| WB protocol for MYCBP antibody 85891-1-RR | Download protocol |
| Citations | - |
| Dilutions | WB : 1:500-1:2000 IF/ICC : 1:50-1:500 |
| Isotype | IgG |
| Clonality | Recombinant |
| Clone Number | 250129G1 |
| Conjugation | Unconjugated |
MYC binding protein(MYCBP), encoded by MYCBP gene, binds to N-terminal region of MYC, and then MYC can activate E box-dependent transcription. Upon increasing expression of MYC , MYCBP translocates into the nucleus in the S phase of the cell cycle. MYCBP may involve in spermatogenesis, since it's found to be interacted with AKAP84/149 in the mitochondria in somatic cells and sperm. It highly expressed in heart, placenta, pancreas,skeletal muscle and kidney, but low in lung. This is a rabbit monoclonal antibody raised against full-length MYCBP of human origin. Protocols Product Specific Protocols IF protocol for MYCBP antibody 85891-1-RR Download protocol WB protocol for MYCBP antibody 85891-1-RR Download protocol Standard Protocols Click here to view our Standard Protocols
Reviews
Write Your Own Review
Related Products
Check items to add to the cart or
