14-3-3 GAMMA-Specific Polyclonal antibody 12381-1-AP proteintech
$149.00
In stock
SKU
12381-1-AP
| Catalog Number | 12381-1-AP |
| Synonyms | 14-3-3 GAMMA, YWHAG, 14 3 3 protein gamma, 14 3 3 protein gamma subtype, 14 3 3GAMMA |
| Host | Rabbit |
| Reactivity | human, mouse, rat, canine |
| Form | Liquid |
| Formulation | PBS, Azide, Glycerol |
| Applications | WB, IHC, IF/ICC, IF-P, IP, CoIP, ELISA |
| Applications | WB, IHC, IF/ICC, IF-P, IP, ELISA |
| Host / Isotype | Rabbit / IgG |
| Tested Applications — Positive WB detected in | mouse IMCD3 cells (RNAi), A431 cells, K-562 cells, NIH/3T3 cells |
| Tested Applications — Positive IP detected in | mouse brain tissue |
| Tested Applications — Positive IHC detected in | human lung cancer tissue, human breast cancer tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
| Tested Applications — Positive IF-P detected in | mouse brain tissue |
| Tested Applications — Positive IF/ICC detected in | MDCK cells |
| Recommended Dilutions — Western Blot (WB) | WB : 1:500-1:1000 |
| Recommended Dilutions — Immunoprecipitation (IP) | IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate |
| Recommended Dilutions — Immunohistochemistry (IHC) | IHC : 1:50-1:500 |
| Recommended Dilutions — Immunofluorescence (IF)-P | IF-P : 1:50-1:500 |
| Recommended Dilutions — Immunofluorescence (IF)/ICC | IF/ICC : 1:50-1:500 |
| Positive WB detected in | mouse IMCD3 cells (RNAi), A431 cells, K-562 cells, NIH/3T3 cells |
| Positive IP detected in | mouse brain tissue |
| Positive IHC detected in | human lung cancer tissue, human breast cancer tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
| Positive IF-P detected in | mouse brain tissue |
| Positive IF/ICC detected in | MDCK cells |
| Western Blot (WB) | WB : 1:500-1:1000 |
| Immunoprecipitation (IP) | IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate |
| Immunohistochemistry (IHC) | IHC : 1:50-1:500 |
| Immunofluorescence (IF)-P | IF-P : 1:50-1:500 |
| Immunofluorescence (IF)/ICC | IF/ICC : 1:50-1:500 |
| Tested Reactivity | human, mouse, rat, canine |
| Cited Reactivity | human, rat |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen | CatNo: Ag3047 Product name: Recombinant human 14 3 3GAMMA protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-247 aa of BC020963 Sequence: MVDREQLVQKARLAEQAERYDDMAAAMKNVTELNEPLSNEERNLLSVAYKNVVGARRSSWRVISSIEQKTSADGNEKKIEMVRAYREKIEKELEAVCQDVLSLLDNYLIKNCSETQYESKVFYLKMKGDYYRYLAEVATGEKRATVVESSEKAYSEAHEISKEHMQPTHPIRLGLALNYSVFYYEIQNAPEQACHLAKTAFDDAIAELDTLNEDSYKDSTLIMQLLRDNLTLWTSDQQDDDGGEGNN Predict reactive species |
| Full Name | tyrosine 3-monooxygenase/tryptophan 5-monooxygenase activation protein, gamma polypeptide |
| Calculated Molecular Weight | 247 aa, 28 kDa |
| Observed Molecular Weight | 28-33 kDa |
| GenBank Accession Number | BC020963 |
| Gene Symbol | 14-3-3 gamma |
| Gene ID (NCBI) | 7532 |
| RRID | AB_2217937 |
| Conjugate | Unconjugated |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | P61981 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA. |
| IF protocol for 14-3-3 GAMMA-Specific antibody 12381-1-AP | Download protocol |
| IHC protocol for 14-3-3 GAMMA-Specific antibody 12381-1-AP | Download protocol |
| IP protocol for 14-3-3 GAMMA-Specific antibody 12381-1-AP | Download protocol |
| WB protocol for 14-3-3 GAMMA-Specific antibody 12381-1-AP | Download protocol |
| human | WB,IP J Exp Clin Cancer Res 14-3-3ζ inhibits heme oxygenase-1 (HO-1) degradation and promotes hepatocellular carcinoma proliferation: involvement of STAT3 signaling. Authors - Jia Song View Article |
| Erik (Verified Customer) (08-26-2021) | We used the antibody at 1:1000 dilution with 11ug input protein, and it produced one clean and strong band at the expected height for the protein Applications: Western Blot Primary Antibody Dilution: 1:1000 Cell Tissue Type: MIAPACA2 and PANC1 cell lines 14-3-3 GAMMA-Specific Antibody Western Blot validation (1:1000 dilution) in MIAPACA2 and PANC1 cell lines (Cat no:12381-1-AP) |
| Citations | 10 |
| Dilutions | WB : 1:500-1:1000 IP : 0.5-4.0 ug for IP and 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate for WB IHC : 1:50-1:500 IF-P : 1:50-1:500 IF/ICC : 1:50-1:500 |
| Isotype | IgG |
| Clonality | Polyclonal |
| Clone Number | - |
| Conjugation | Unconjugated |
14-3-3 gamma (also known as YWHAG) is a member of 14-3-3 proteins which were the first phosphoserine/phosphothreonine-binding proteins to be discovered. 14-3-3 family members interact with a wide spectrum of proteins and possess diverse functions. Mammals express seven distinct 14-3-3 isoforms (gamma, epsilon, beta, zeta, sigma, theta, tau) that form multiple homo- and hetero- dimmers. 14-3-3 proteins display the highest expression levels in the brain, and have been implicated in several neurodegenerative diseases, including Alzheimer's disease and amyotrophic lateral sclerosis. This antibody specifically recognizes gamma isoform of 14-3-3. Protocols Product Specific Protocols IF protocol for 14-3-3 GAMMA-Specific antibody 12381-1-AP Download protocol IHC protocol for 14-3-3 GAMMA-Specific antibody 12381-1-AP Download protocol IP protocol for 14-3-3 GAMMA-Specific antibody 12381-1-AP Download protocol WB protocol for 14-3-3 GAMMA-Specific antibody 12381-1-AP Download protocol Standard Protocols Click here to view our Standard Protocols
Publications
- Endonuclease G promotes autophagy by suppressing mTOR signaling and activating the DNA damage response.
Journal: Nat Commun | Authors: Wenjun Wang | Species: human | Application: WB,CoIP - Human adipocyte differentiation and composition of disease-relevant lipids are regulated by miR-221-3p.
Journal: Biochim Biophys Acta Mol Cell Biol Lipids | Authors: Maria A Ahonen | Species: human | Application: WB - Proteome analysis of porcine epidemic diarrhea virus (PEDV)-infected vero cells.
Journal: Proteomics | Authors: Songlin Zeng | Species: human | Application: WB - TRIM28-mediated SUMOylation of G3BP1/2 regulates stress granule dynamics.
Journal: Cell Chem Biol | Authors: Yi Yuan | Species: human | Application: IF - YWHAG promotes the progression of lung adenocarcinoma through the JAK2/STAT3 pathway
Journal: Cancer Cell Int | Authors: Hongmei Zheng | Species: human | Application: WB,IHC - 14-3-3ζ inhibits heme oxygenase-1 (HO-1) degradation and promotes hepatocellular carcinoma proliferation: involvement of STAT3 signaling.
Journal: J Exp Clin Cancer Res | Authors: Jia Song | Species: human | Application: WB,IP - YWHAG promotes colorectal cancer progression by regulating the CTTN-Wnt/β-catenin signaling axis
Journal: Med Oncol | Authors: Yuanben Wang | Species: human | Application: WB,IHC - Proteome analysis of porcine epidemic diarrhea virus (PEDV)-infected vero cells.
Journal: Proteomics | Authors: Songlin Zeng | Species: human | Application: WB - Human adipocyte differentiation and composition of disease-relevant lipids are regulated by miR-221-3p.
Journal: Biochim Biophys Acta Mol Cell Biol Lipids | Authors: Maria A Ahonen | Species: human | Application: WB - miR-200a-3p inhibits the PDGF-BB-induced proliferation of VSMCs by affecting their phenotype-associated proteins
Journal: J Biochem Mol Toxicol | Authors: Rui-Yuan Zeng | Species: rat | Application: WB
Reviews
Write Your Own Review
Related Products
Check items to add to the cart or
