Malectin Polyclonal antibody 26655-1-AP proteintech
$149.00
In stock
SKU
26655-1-AP
| Catalog Number | 26655-1-AP |
| Synonyms | MLEC, KIAA0152 |
| Host | Rabbit |
| Reactivity | human, mouse, rat |
| Form | Liquid |
| Formulation | PBS, Azide, Glycerol |
| Applications | WB, IHC, IF, ELISA |
| Applications | WB, IHC, ELISA |
| Host / Isotype | Rabbit / IgG |
| Tested Applications — Positive WB detected in | mouse colon tissue, human placenta tissue, rat colon tissue |
| Tested Applications — Positive IHC detected in | mouse colon tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
| Recommended Dilutions — Western Blot (WB) | WB : 1:500-1:1000 |
| Recommended Dilutions — Immunohistochemistry (IHC) | IHC : 1:50-1:500 |
| Positive WB detected in | mouse colon tissue, human placenta tissue, rat colon tissue |
| Positive IHC detected in | mouse colon tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
| Western Blot (WB) | WB : 1:500-1:1000 |
| Immunohistochemistry (IHC) | IHC : 1:50-1:500 |
| Tested Reactivity | human, mouse, rat |
| Cited Reactivity | human, mouse, rat |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen | CatNo: Ag24379 Product name: Recombinant human MLEC protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 106-269 aa of BC000371 Sequence: EETFGYEVPIKEEGDYVLVLKFAEVYFAQSQQKVFDVRLNGHVVVKDLDIFDRVGHSTAHDEIIPMSIRKGKLSVQGEVSTFTGKLYIEFVKGYYDNPKVCALYIMAGTVDDVPKLQPHPGLEKKEEEEEEEEYDEGSNLKKQTNKNRVQSGPRTPNPYASDNS Predict reactive species |
| Full Name | malectin |
| Calculated Molecular Weight | 292 aa, 32 kDa |
| Observed Molecular Weight | 32 kDa |
| GenBank Accession Number | BC000371 |
| Gene Symbol | Malectin |
| Gene ID (NCBI) | 9761 |
| RRID | AB_2880591 |
| Conjugate | Unconjugated |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | Q14165 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA. |
| IHC protocol for Malectin antibody 26655-1-AP | Download protocol |
| WB protocol for Malectin antibody 26655-1-AP | Download protocol |
| rat | WB J Cell Biol Competition for calnexin binding regulates secretion and turnover of misfolded GPI-anchored proteins Authors - Amber M Cheatham View Article |
| human | WB Adv Sci (Weinh) Malectin Alleviates Endoplasmic Reticulum Stress in Gestational Diabetes Mellitus via Glycoprotein Quality Control Mechanisms. Authors - Jiahui Zhu KD Validated View Article |
| mouse | WB,IF Nat Commun The mechanisms to dispose of misfolded proteins in the endoplasmic reticulum of adipocytes Authors - Shuangcheng Alivia Wu View Article |
| Citations | 10 |
| Dilutions | WB : 1:500-1:1000 IHC : 1:50-1:500 |
| Isotype | IgG |
| Clonality | Polyclonal |
| Clone Number | - |
| Conjugation | Unconjugated |
Malectin is a conserved, endoplasmic reticulum (ER)-resident lectin that recognizes high mannose oligosaccharides displaying terminal glucose residues. Like other intracellular lectins involved in glycoprotein quality control, malectin is highly conserved in animals (PMID: 21298103). Protocols Product Specific Protocols IHC protocol for Malectin antibody 26655-1-AP Download protocol WB protocol for Malectin antibody 26655-1-AP Download protocol Standard Protocols Click here to view our Standard Protocols
Publications
- Competition for calnexin binding regulates secretion and turnover of misfolded GPI-anchored proteins
Journal: J Cell Biol | Authors: Amber M Cheatham | Species: rat | Application: WB - Blood coagulation factor VIII D1241E polymorphism leads to a weak malectin interaction and reduction of factor VIII posttranslational modification and secretion.
Journal: Exp Cell Res | Authors: Ning Jiang KD Validated | Species: human | Application: WB - The prolyl isomerase FKBP11 is a secretory translocon accessory factor
Journal: Mol Biol Cell | Authors: Amanda DiGuilio - Integrated Structural Analysis of N-Glycans and Free Oligosaccharides Allows for a Quantitative Evaluation of ER Stress.
Journal: Biochemistry | Authors: Naoki Fujitani | Species: human | Application: WB - Malectin Alleviates Endoplasmic Reticulum Stress in Gestational Diabetes Mellitus via Glycoprotein Quality Control Mechanisms.
Journal: Adv Sci (Weinh) | Authors: Jiahui Zhu KD Validated | Species: human | Application: WB - The mechanisms to dispose of misfolded proteins in the endoplasmic reticulum of adipocytes
Journal: Nat Commun | Authors: Shuangcheng Alivia Wu | Species: mouse | Application: WB,IF - Blood coagulation factor VIII D1241E polymorphism leads to a weak malectin interaction and reduction of factor VIII posttranslational modification and secretion.
Journal: Exp Cell Res | Authors: Ning Jiang | Species: human | Application: WB - The prolyl isomerase FKBP11 is a secretory translocon accessory factor
Journal: Mol Biol Cell | Authors: Amanda DiGuilio - Integrated Structural Analysis of N-Glycans and Free Oligosaccharides Allows for a Quantitative Evaluation of ER Stress.
Journal: Biochemistry | Authors: Naoki Fujitani | Species: human | Application: WB - The glycoprotein quality control factor Malectin promotes coronavirus replication and viral protein biogenesis
Journal: bioRxiv | Authors: Jonathan P Davies | Species: mouse | Application: WB
Reviews
Write Your Own Review
Related Products
Check items to add to the cart or
