NANOS3 Polyclonal antibody 21679-1-AP proteintech
$149.00
In stock
SKU
21679-1-AP
| Catalog Number | 21679-1-AP |
| Synonyms | NOS-3, NOS3, NOS 3, NANOS1L, nanos homolog 3 (Drosophila) |
| Host | Rabbit |
| Reactivity | human, mouse, rat and More (1) |
| Reactivity | human, mouse, rat, monkey |
| Form | Liquid |
| Formulation | PBS, Azide, Glycerol |
| Applications | WB, IHC, IF, ELISA |
| Applications | WB, IHC, ELISA |
| Host / Isotype | Rabbit / IgG |
| Tested Applications — Positive WB detected in | mouse testis tissue, HEK-293 cells |
| Tested Applications — Positive IHC detected in | human testis tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
| Recommended Dilutions — Western Blot (WB) | WB : 1:200-1:1000 |
| Recommended Dilutions — Immunohistochemistry (IHC) | IHC : 1:50-1:500 |
| Positive WB detected in | mouse testis tissue, HEK-293 cells |
| Positive IHC detected in | human testis tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
| Western Blot (WB) | WB : 1:200-1:1000 |
| Immunohistochemistry (IHC) | IHC : 1:50-1:500 |
| Tested Reactivity | human, mouse, rat |
| Cited Reactivity | human, mouse, rat, monkey |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen | CatNo: Ag16014 Product name: Recombinant human NANOS3 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-192 aa of BC101209 Sequence: MGTFDLWTDYLGLAHLVRALSGKEGPETRLSPQPEPEPMLEPVSALEPMPAPESVPVPGPKDQKRSLESSPAPERLCSFCKHNGESRAIYQSHVLKDEAGRVLCPILRDYVCPQCGATRERAHTRRFCPLTGQGYTSVYSHTTRNSAGKKLVRPDKAKTQDTGHRRGGGGGAGFRGAGKSEPSPSCSPSMST Predict reactive species |
| Full Name | nanos homolog 3 (Drosophila) |
| Calculated Molecular Weight | 192 aa, 21 kDa |
| Observed Molecular Weight | 26-30 kDa |
| GenBank Accession Number | BC101209 |
| Gene Symbol | NANOS3 |
| Gene ID (NCBI) | 342977 |
| RRID | AB_10859250 |
| Conjugate | Unconjugated |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | P60323 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA. |
| IHC protocol for NANOS3 antibody 21679-1-AP | Download protocol |
| WB protocol for NANOS3 antibody 21679-1-AP | Download protocol |
| mouse | WB J Ethnopharmacol Zhenwu decoction ameliorates cardiac hypertrophy through activating sGC (soluble guanylate cyclase) - cGMP (cyclic guanosine monophosphate) - PKG (protein kinase G) pathway Authors - Liqian Chen View Article |
| mouse,rat | WB,IF Environ Pollut Wnt10a downregulation contributes to MEHP-induced disruption of self-renewal and differentiation balance and proliferation inhibition in GC-1 cells: Insights from multiple transcriptomic profiling Authors - Yifan Hong View Article |
| human | WB,IHC BMC Cancer A new mouse model to study the role of ectopic Nanos3 expression in cancer. Authors - Vanessa Andries View Article |
| rat | WB Exp Cell Res Pum2 mediates Sirt1 mRNA decay and exacerbates hypoxia/reoxygenation-induced cardiomyocyte apoptosis. Authors - Yuanping Cao View Article |
| Citations | 8 |
| Dilutions | WB : 1:200-1:1000 IHC : 1:50-1:500 |
| Isotype | IgG |
| Clonality | Polyclonal |
| Clone Number | - |
| Conjugation | Unconjugated |
The NANOS gene family is required for germ cell development in diverse organisms. NANOS3 is found in migrating primordial germ cells, and the homozygous deficiency of NANOS3 in the mouse results in the complete loss of germ cells in both sexes. Protocols Product Specific Protocols IHC protocol for NANOS3 antibody 21679-1-AP Download protocol WB protocol for NANOS3 antibody 21679-1-AP Download protocol Standard Protocols Click here to view our Standard Protocols
Publications
- Regulation of both transcription and RNA turnover contribute to germline specification.
Journal: Nucleic Acids Res | Authors: Kun Tan | Species: mouse | Application: IF - Wnt10a downregulation contributes to MEHP-induced disruption of self-renewal and differentiation balance and proliferation inhibition in GC-1 cells: Insights from multiple transcriptomic profiling
Journal: Environ Pollut | Authors: Yifan Hong | Species: mouse,rat | Application: WB,IF - The human NANOS3 gene contributes to lung tumour invasion by inducing epithelial-mesenchymal transition.
Journal: J Pathol | Authors: Simon Grelet | Species: human | Application: WB,IHC,IF - Pum2 mediates Sirt1 mRNA decay and exacerbates hypoxia/reoxygenation-induced cardiomyocyte apoptosis.
Journal: Exp Cell Res | Authors: Yuanping Cao | Species: rat | Application: WB - A new mouse model to study the role of ectopic Nanos3 expression in cancer.
Journal: BMC Cancer | Authors: Vanessa Andries | Species: human | Application: WB,IHC - Zhenwu decoction ameliorates cardiac hypertrophy through activating sGC (soluble guanylate cyclase) - cGMP (cyclic guanosine monophosphate) - PKG (protein kinase G) pathway
Journal: J Ethnopharmacol | Authors: Liqian Chen | Species: mouse | Application: WB - Pum2 mediates Sirt1 mRNA decay and exacerbates hypoxia/reoxygenation-induced cardiomyocyte apoptosis.
Journal: Exp Cell Res | Authors: Yuanping Cao | Species: rat | Application: WB - The topographical distribution of spermatogonial subpopulations during the cycle of seminiferous epithelium in Macaca Fascicularis.
Journal: Biol Reprod | Authors: Martina Palazzi | Species: monkey | Application: IHC
Reviews
Write Your Own Review
Related Products
Check items to add to the cart or
