NCOA5 Polyclonal antibody 20175-1-AP proteintech
$149.00
In stock
SKU
20175-1-AP
| Catalog Number | 20175-1-AP |
| Synonyms | CIA, Coactivator independent of AF-2, KIAA1637, NCoA-5, Nuclear receptor coactivator 5 |
| Host | Rabbit |
| Reactivity | human, mouse and More (1) |
| Reactivity | human, mouse, bovine |
| Form | Liquid |
| Formulation | PBS, Azide, Glycerol |
| Applications | WB, IHC, IF/ICC, FC (Intra), IP, ChIP, ELISA |
| Applications | WB, IHC, IF/ICC, FC (Intra), IP, ELISA |
| Host / Isotype | Rabbit / IgG |
| Tested Applications — Positive WB detected in | HEK-293 cells, HeLa cells |
| Tested Applications — Positive IP detected in | HEK-293 cells |
| Tested Applications — Positive IHC detected in | human stomach tissue, mouse testis tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
| Tested Applications — Positive IF/ICC detected in | A431 cells |
| Tested Applications — Positive FC (Intra) detected in | HEK-293 cells |
| Recommended Dilutions — Western Blot (WB) | WB : 1:1000-1:4000 |
| Recommended Dilutions — Immunoprecipitation (IP) | IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate |
| Recommended Dilutions — Immunohistochemistry (IHC) | IHC : 1:200-1:800 |
| Recommended Dilutions — Immunofluorescence (IF)/ICC | IF/ICC : 1:50-1:500 |
| Recommended Dilutions — Flow Cytometry (FC) (INTRA) | FC (INTRA) : 0.25 ug per 10^6 cells in a 100 µl suspension |
| Positive WB detected in | HEK-293 cells, HeLa cells |
| Positive IP detected in | HEK-293 cells |
| Positive IHC detected in | human stomach tissue, mouse testis tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
| Positive IF/ICC detected in | A431 cells |
| Positive FC (Intra) detected in | HEK-293 cells |
| Western Blot (WB) | WB : 1:1000-1:4000 |
| Immunoprecipitation (IP) | IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate |
| Immunohistochemistry (IHC) | IHC : 1:200-1:800 |
| Immunofluorescence (IF)/ICC | IF/ICC : 1:50-1:500 |
| Flow Cytometry (FC) (INTRA) | FC (INTRA) : 0.25 ug per 10^6 cells in a 100 µl suspension |
| Tested Reactivity | human, mouse |
| Cited Reactivity | human, mouse, bovine |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen | CatNo: Ag14014 Product name: Recombinant human NCOA5 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 112-384 aa of BC056872 Sequence: DMRDSRDPMYRREGSYDRYLRMDDYCRRKDDSYFDRYRDSFDGRGPPGPESQSRAKERLKREERRREELYRQYFEEIQRRFDAERPVDCSVIVVNKQTKDYAESVGRKVRDLGMVVDLIFLNTEVSLSQALEDVSRGGSPFAIVITQQHQIHRSCTVNIMFGTPQEHRNMPQADAMVLVARNYERYKNECREKEREEIARQAAKMADEAILQERERGGPEEGVRGGHPPAIQSLINLLADNRYLTAEETDKIINYLRERKERLMRSSTDSLPG Predict reactive species |
| Full Name | nuclear receptor coactivator 5 |
| Calculated Molecular Weight | 579 aa, 66 kDa |
| Observed Molecular Weight | 66 kDa |
| GenBank Accession Number | BC056872 |
| Gene Symbol | NCOA5 |
| Gene ID (NCBI) | 57727 |
| RRID | AB_10694674 |
| Conjugate | Unconjugated |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | Q9HCD5 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA. |
| FC protocol for NCOA5 antibody 20175-1-AP | Download protocol |
| IF protocol for NCOA5 antibody 20175-1-AP | Download protocol |
| IHC protocol for NCOA5 antibody 20175-1-AP | Download protocol |
| IP protocol for NCOA5 antibody 20175-1-AP | Download protocol |
| WB protocol for NCOA5 antibody 20175-1-AP | Download protocol |
| mouse | IF Cell Rep SILAC Proteomics of Planarians Identifies Ncoa5 as a Conserved Component of Pluripotent Stem Cells. Authors - B?ser Alexander A View Article |
| bovine | WB,IF,ChIP Biochem Biophys Res Commun NCOA5 is a master regulator of amino acid-induced mTOR activation and β-casein synthesis in bovine mammary epithelial cells. Authors - Xiaohan Yuan KD Validated View Article |
| human | WB,IHC Cell Death Discov NCOA5 induces sorafenib resistance in hepatocellular carcinoma by inhibiting ferroptosis Authors - Shuang Gao KD Validated View Article |
| Matthew (Verified Customer) (10-01-2025) | Got great signal on both my western blot and immunofluorescence experiments when over-expressing NCOA5. I will definitely use in the future for other applications! Applications: Western Blot, Immunofluorescence Primary Antibody Dilution: 1:100 (IF); 1:1000 (WB) Cell Tissue Type: 22rv1, PC3 |
| Moritz (Verified Customer) (09-26-2025) | worked well for HEK293T cells Applications: Western Blot Primary Antibody Dilution: 1:2000 Cell Tissue Type: HEK293T NCOA5 Antibody Western Blot validation (1:2000 dilution) in HEK293T (Cat no:20175-1-AP) |
| Aleksandr (Verified Customer) (12-16-2024) | Excellent antibody Applications: Western Blot Primary Antibody Dilution: 1:2500 Cell Tissue Type: RKO NCOA5 Antibody Western Blot validation (1:2500 dilution) in RKO (Cat no:20175-1-AP) |
| Tsimafei (Verified Customer) (08-07-2024) | Antibody recognize Ncoa5 band as well as (weakly) the upper non-specific band Applications: Western Blot Primary Antibody Dilution: 1:2000 Cell Tissue Type: U2OS NCOA5 Antibody Western Blot validation (1:2000 dilution) in U2OS (Cat no:20175-1-AP) |
| Julia (Verified Customer) (07-16-2024) | Alright. You can see some non-specific bands and ladder-binding but the correct band is more distinct. Applications: Western Blot Primary Antibody Dilution: 1:2000 Cell Tissue Type: mESC NCOA5 Antibody Western Blot validation (1:2000 dilution) in mESC (Cat no:20175-1-AP) |
| Citations | 4 |
| Dilutions | WB : 1:1000-1:4000 IP : 0.5-4.0 ug for IP and 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate for WB IHC : 1:200-1:800 IF/ICC : 1:50-1:500 FC (INTRA) : 0.25 ug per 10^6 cells in a 100 µl suspension |
| Isotype | IgG |
| Clonality | Polyclonal |
| Clone Number | - |
| Conjugation | Unconjugated |
Nuclear receptor coactivator 5 (NCOA5), also known as coactivator independent of AF-2 (CIA), possesses both repressor and activator functions (PMID: 11113208). It can interact with Estrogen Receptor (ER) alpha and ER beta in a ligand-dependent manner. NCOA5 has been shown to regulate the ER alpha-mediated transcription as well as the expression of the c-Myc gene (PMID: 11113208; 15073177). Recently identified as a conserved component of pluripotent stem cells, mammalian NCOA5 may contribute to the maintenance of the pluripotent stem cell population (PMID: 24268775). Protocols Product Specific Protocols FC protocol for NCOA5 antibody 20175-1-AP Download protocol IF protocol for NCOA5 antibody 20175-1-AP Download protocol IHC protocol for NCOA5 antibody 20175-1-AP Download protocol IP protocol for NCOA5 antibody 20175-1-AP Download protocol WB protocol for NCOA5 antibody 20175-1-AP Download protocol Standard Protocols Click here to view our Standard Protocols
Publications
- SILAC Proteomics of Planarians Identifies Ncoa5 as a Conserved Component of Pluripotent Stem Cells.
Journal: Cell Rep | Authors: B?ser Alexander A | Species: mouse | Application: IF - NCOA5 is a master regulator of amino acid-induced mTOR activation and β-casein synthesis in bovine mammary epithelial cells.
Journal: Biochem Biophys Res Commun | Authors: Xiaohan Yuan KD Validated | Species: bovine | Application: WB,IF,ChIP - Nuclear 2'-O-methylation regulates RNA splicing through its binding protein FUBP1.
Journal: Sci Adv | Authors: Boyang Gao | Species: human | Application: WB - NCOA5 induces sorafenib resistance in hepatocellular carcinoma by inhibiting ferroptosis
Journal: Cell Death Discov | Authors: Shuang Gao KD Validated | Species: human | Application: WB,IHC
Reviews
Write Your Own Review
Related Products
Check items to add to the cart or
