NDUFA11 Polyclonal antibody 17879-1-AP proteintech
$149.00
In stock
SKU
17879-1-AP
| Catalog Number | 17879-1-AP |
| Synonyms | B14.7, CI B14.7, CI-B14.7, Complex I B14.7, Complex I-B14.7 |
| Host | Rabbit |
| Reactivity | human |
| Form | Liquid |
| Formulation | PBS, Azide, Glycerol |
| Applications | WB, IHC, ELISA |
| Host / Isotype | Rabbit / IgG |
| Tested Applications — Positive WB detected in | HeLa cells, MDA-MB-231 cells, RT-4 cells, U-251 cells |
| Tested Applications — Positive IHC detected in | human placenta tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
| Recommended Dilutions — Western Blot (WB) | WB : 1:1000-1:8000 |
| Recommended Dilutions — Immunohistochemistry (IHC) | IHC : 1:500-1:2000 |
| Positive WB detected in | HeLa cells, MDA-MB-231 cells, RT-4 cells, U-251 cells |
| Positive IHC detected in | human placenta tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
| Western Blot (WB) | WB : 1:1000-1:8000 |
| Immunohistochemistry (IHC) | IHC : 1:500-1:2000 |
| Tested Reactivity | human |
| Cited Reactivity | human |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen | CatNo: Ag11746 Product name: Recombinant human NDUFA11 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 1-111 aa of BC069045 Sequence: MAPKVFRQYWDIPDGTDCHRKAYSTTSIASVAGLTAAAYRVTLNPPGTFLEGVAKVGQYTFTAAAVGAVFGLTTCISAHVREKPDDPLNYFLGGCAGGLTLGARTHNYGIG Predict reactive species |
| Full Name | NADH dehydrogenase (ubiquinone) 1 alpha subcomplex, 11, 14.7kDa |
| Calculated Molecular Weight | 141 aa, 15 kDa |
| Observed Molecular Weight | 10-15 kDa |
| GenBank Accession Number | BC069045 |
| Gene Symbol | NDUFA11 |
| Gene ID (NCBI) | 126328 |
| RRID | AB_3669282 |
| Conjugate | Unconjugated |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | Q86Y39 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA. |
| IHC protocol for NDUFA11 antibody 17879-1-AP | Download protocol |
| WB protocol for NDUFA11 antibody 17879-1-AP | Download protocol |
| human | WB Int J Mol Sci RORα Suppresses Cancer-Associated Inflammation by Repressing Respiratory Complex I-Dependent ROS Generation. Authors - Wei Mao View Article |
| Citations | 3 |
| Dilutions | WB : 1:1000-1:8000 IHC : 1:500-1:2000 |
| Isotype | IgG |
| Clonality | Polyclonal |
| Clone Number | - |
| Conjugation | Unconjugated |
Mitochondrial complex I is assembled from 44 subunits into an L-shaped complex, with a hydrophobic arm embedded in the inner mitochondrial membrane and the other arm protruding into the mitochondrial matrix. NDUFA11 encodes a subunit of the membrane-bound mitochondrial complex I, and functions in assembly, stability, and regulation of the complex. Mutations in NDUFA11 are associated with severe mitochondrial complex I deficiency(PMID: 18306244). Protocols Product Specific Protocols IHC protocol for NDUFA11 antibody 17879-1-AP Download protocol WB protocol for NDUFA11 antibody 17879-1-AP Download protocol Standard Protocols Click here to view our Standard Protocols
Publications
- Based on disulfide accumulation, leveraging a THBS1-signature to improve the outcome of head and neck carcinoma patients.
Journal: Int J Biol Macromol | Authors: Yi Jin | Species: human | Application: WB - Molecular subtypes and prognostic signature rooted in disulfidptosis highlight tumor microenvironment in lung adenocarcinoma.
Journal: Chin J Cancer Res | Authors: Xia Wei | Species: human | Application: WB - RORα Suppresses Cancer-Associated Inflammation by Repressing Respiratory Complex I-Dependent ROS Generation.
Journal: Int J Mol Sci | Authors: Wei Mao | Species: human | Application: WB
Reviews
Write Your Own Review
Related Products
Check items to add to the cart or
