CoraLite® Plus 488-conjugated NDUFA4L2 Monoclonal antibody CL488-66050 proteintech
$479.00
In stock
SKU
CL488-66050
| Catalog Number | CL488-66050 |
| Synonyms | FLJ26118, NDUFA4L2, NUOMS |
| Host | Mouse |
| Reactivity | human |
| Form | Liquid |
| Formulation | PBS, Proclin300, BSA, Glycerol |
| Applications | IF/ICC |
| Host / Isotype | Mouse / IgG2a |
| Tested Applications — Positive IF/ICC detected in | MCF-7 cells |
| Recommended Dilutions — Immunofluorescence (IF)/ICC | IF/ICC : 1:50-1:500 |
| Positive IF/ICC detected in | MCF-7 cells |
| Immunofluorescence (IF)/ICC | IF/ICC : 1:50-1:500 |
| Tested Reactivity | human |
| Class | Monoclonal |
| Type | Antibody |
| Immunogen | CatNo: Ag9233 Product name: Recombinant human NDUFA4L2 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 1-87 aa of BC011910 Sequence: MAGASLGARFYRQIKRHPGIIPMIGLICLGMGSAALYLLRLALRSPDVCWDRKNNPEPWNRLSPNDQYKFLAVSTDYKKLKKDRPDF Predict reactive species |
| Full Name | NADH dehydrogenase (ubiquinone) 1 alpha subcomplex, 4-like 2 |
| Calculated Molecular Weight | 87 aa, 10 kDa |
| Observed Molecular Weight | 10 kDa |
| GenBank Accession Number | BC011910 |
| Gene Symbol | NDUFA4L2 |
| Gene ID (NCBI) | 56901 |
| RRID | AB_2883240 |
| Conjugate | CoraLite® Plus 488 Fluorescent Dye |
| Excitation/Emission Maxima Wavelengths | 493 nm / 522 nm |
| Excitation Laser | Blue laser (488 nm) |
| Purification Method | Protein A purification |
| UNIPROT ID | Q9NRX3 |
| Storage Buffer | PBS with 50% glycerol, 0.05% Proclin300, 0.5% BSA, pH 7.3. |
| Storage Conditions | Store at -20°C. Avoid exposure to light. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. |
| IF protocol for CL Plus 488 NDUFA4L2 antibody CL488-66050 | Download protocol |
| Citations | - |
| Dilutions | IF/ICC : 1:50-1:500 |
| Isotype | IgG2a |
| Clonality | Monoclonal |
| Clone Number | 1G1H10 |
| Conjugation | CoraLite® Plus 488 |
NDUFA4L2, also named as NUOMS, is a HIF-1α target gene that localizes to the mitochondria. It downregulates oxygen consumption and Complex I activity in hypoxia. NDUFA4L2 is involved in hypoxic adaptation by decreasing mitochondrial ROS production. Protocols Product Specific Protocols IF protocol for CL Plus 488 NDUFA4L2 antibody CL488-66050 Download protocol Standard Protocols Click here to view our Standard Protocols
Product Documents
Reviews
Write Your Own Review
Related Products
Check items to add to the cart or
