NELF Recombinant monoclonal antibody 83490-2-RR proteintech
$149.00
In stock
SKU
83490-2-RR
| Catalog Number | 83490-2-RR |
| Synonyms | NSMF, 240482G1, Nasal embryonic LHRH factor, Nasal embryonic luteinizing hormone-releasing hormone factor, NMDA receptor synaptonuclear signaling and neuronal migration factor |
| Host | Rabbit |
| Reactivity | human |
| Form | Liquid |
| Formulation | PBS, Azide, Glycerol |
| Applications | WB, ELISA |
| Host / Isotype | Rabbit / IgG |
| Tested Applications — Positive WB detected in | COLO 320 cells, HeLa cells, HepG2 cells |
| Recommended Dilutions — Western Blot (WB) | WB : 1:5000-1:50000 |
| Positive WB detected in | COLO 320 cells, HeLa cells, HepG2 cells |
| Western Blot (WB) | WB : 1:5000-1:50000 |
| Tested Reactivity | human |
| Class | Recombinant |
| Type | Antibody |
| Immunogen | CatNo: Ag34902 Product name: Recombinant human NELF protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 151-268 aa of BC016862 Sequence: KLNVYHKGAKIWKMLIFCQGGPGHLYLLKNKVATFAKVEKEEDMIHFWKRLSRLMSKVNPEPNVIHIMGCYILGNPNGEKLFQNLRTLMTPYRVTFESPLELSAQGKQMIETYFDFRL Predict reactive species |
| Full Name | nasal embryonic LHRH factor |
| Calculated Molecular Weight | 507 aa, 56 kDa |
| Observed Molecular Weight | 54-60 kDa |
| GenBank Accession Number | BC016862 |
| Gene Symbol | NELF |
| Gene ID (NCBI) | 26012 |
| RRID | AB_3671117 |
| Conjugate | Unconjugated |
| Purification Method | Protein A purification |
| UNIPROT ID | Q6X4W1 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA. |
| WB protocol for NELF antibody 83490-2-RR | Download protocol |
| Citations | - |
| Dilutions | WB : 1:5000-1:50000 |
| Isotype | IgG |
| Clonality | Recombinant |
| Clone Number | 240482G1 |
| Conjugation | Unconjugated |
NSMF, also named as NELF (Nasal embryonic LHRH factor), couples NMDA-sensitive glutamate receptor signaling to the nucleus and triggers long-lasting changes in the cytoarchitecture of dendrites and spine synapse processes. NELF plays a major role in promoter-proximal pausing, a widespread phenomenon during early transcription elongation. Protocols Product Specific Protocols WB protocol for NELF antibody 83490-2-RR Download protocol Standard Protocols Click here to view our Standard Protocols
Product Documents
Reviews
Write Your Own Review
Related Products
Check items to add to the cart or
