NKX2-2 Polyclonal antibody 13013-1-AP proteintech
$149.00
In stock
SKU
13013-1-AP
| Catalog Number | 13013-1-AP |
| Synonyms | Homeobox protein NK-2 homolog B, Homeobox protein Nkx 2.2, Homeobox protein Nkx-2.2, NKX2 2, NKX2.2 |
| Host | Rabbit |
| Reactivity | human, mouse, rat and More (1) |
| Reactivity | human, mouse, rat, pig |
| Form | Liquid |
| Formulation | PBS, Azide, Glycerol |
| Applications | WB, IHC, IF, ChIP, ELISA |
| Applications | WB, IHC, ELISA |
| Host / Isotype | Rabbit / IgG |
| Tested Applications — Positive WB detected in | Min6 cells |
| Tested Applications — Positive IHC detected in | mouse brain tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
| Recommended Dilutions — Western Blot (WB) | WB : 1:500-1:1000 |
| Recommended Dilutions — Immunohistochemistry (IHC) | IHC : 1:250-1:1000 |
| Positive WB detected in | Min6 cells |
| Positive IHC detected in | mouse brain tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
| Western Blot (WB) | WB : 1:500-1:1000 |
| Immunohistochemistry (IHC) | IHC : 1:250-1:1000 |
| Tested Reactivity | human, mouse, rat |
| Cited Reactivity | human, mouse, rat, pig |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen | CatNo: Ag4069 Product name: Recombinant human NKX2-2 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-129 aa of BC075092 Sequence: MSLTNTKTGFSVKDILDLPDTNDEEGSVAEGPEEENEGPEPAKRAGPLGQGALDAVQSLPLKNPFYDSSDNPYTRWLASTEGLQYSLHGLAAGAPPQDSSSKSPEPSADESPDNDKETPGGGGDAGKKR Predict reactive species |
| Full Name | NK2 homeobox 2 |
| Calculated Molecular Weight | 273 aa, 30 kDa |
| Observed Molecular Weight | 30 kDa |
| GenBank Accession Number | BC075092 |
| Gene Symbol | NKX2-2 |
| Gene ID (NCBI) | 4821 |
| RRID | AB_2877903 |
| Conjugate | Unconjugated |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | O95096 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA. |
| IHC protocol for NKX2-2 antibody 13013-1-AP | Download protocol |
| mouse | IF Cell Rep Spatiotemporal role of SETD2-H3K36me3 in murine pancreatic organogenesis Authors - Ping Lu View Article |
| human | WB J Cancer NK homeobox 2.2 functions as tumor suppressor in colorectal cancer due to DNA methylation. Authors - Yuan He View Article |
| rat | WB J Ethnopharmacol Shenzhiling oral liquid protects the myelin sheath against Alzheimer's disease through the PI3K/Akt-mTOR pathway. Authors - Mingcui Zheng View Article |
| Citations | 10 |
| Dilutions | WB : 1:500-1:1000 IHC : 1:250-1:1000 |
| Isotype | IgG |
| Clonality | Polyclonal |
| Clone Number | - |
| Conjugation | Unconjugated |
Publications
- Nuclear import carrier Hikeshi cooperates with HSP70 to promote murine oligodendrocyte differentiation and CNS myelination
Journal: Dev Cell | Authors: Li Li | Species: mouse | Application: WB - EWS-FLI1 regulates and cooperates with core regulatory circuitry in Ewing sarcoma.
Journal: Nucleic Acids Res | Authors: Xianping Shi | Species: human | Application: WB - Spatiotemporal role of SETD2-H3K36me3 in murine pancreatic organogenesis
Journal: Cell Rep | Authors: Ping Lu | Species: mouse | Application: IF - Development of a Chemical Cocktail That Rescues Mouse Brain Demyelination in a Cuprizone-Induced Model.
Journal: Cells | Authors: Pei-Lun Lai | Species: human | Application: WB - Shenzhiling oral liquid protects the myelin sheath against Alzheimer's disease through the PI3K/Akt-mTOR pathway.
Journal: J Ethnopharmacol | Authors: Mingcui Zheng | Species: rat | Application: WB - NK homeobox 2.2 functions as tumor suppressor in colorectal cancer due to DNA methylation.
Journal: J Cancer | Authors: Yuan He | Species: human | Application: WB
Product Documents
Reviews
Write Your Own Review
Related Products
Check items to add to the cart or
