NR2E3 Polyclonal antibody 14246-1-AP proteintech
$149.00
In stock
SKU
14246-1-AP
| Catalog Number | 14246-1-AP |
| Synonyms | Rd 7, PNR, Photoreceptor-specific nuclear receptor, NR2 E3, NR 2E3 |
| Host | Rabbit |
| Reactivity | human, mouse, rat, pig and More (1) |
| Reactivity | human, mouse, rat, pig, zebrafish |
| Form | Liquid |
| Formulation | PBS, Azide, Glycerol |
| Applications | WB, IHC, IF/ICC, ELISA |
| Host / Isotype | Rabbit / IgG |
| Tested Applications — Positive WB detected in | mouse retina tissue, Y79 cells, HepG2 cells, rat retina tissue |
| Tested Applications — Positive IHC detected in | human prostate cancer tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
| Tested Applications — Positive IF/ICC detected in | photoreceptor progenitor cells |
| Recommended Dilutions — Western Blot (WB) | WB : 1:2000-1:12000 |
| Recommended Dilutions — Immunohistochemistry (IHC) | IHC : 1:20-1:200 |
| Recommended Dilutions — Immunofluorescence (IF)/ICC | IF/ICC : 1:20-1:100 |
| Positive WB detected in | mouse retina tissue, Y79 cells, HepG2 cells, rat retina tissue |
| Positive IHC detected in | human prostate cancer tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
| Positive IF/ICC detected in | photoreceptor progenitor cells |
| Western Blot (WB) | WB : 1:2000-1:12000 |
| Immunohistochemistry (IHC) | IHC : 1:20-1:200 |
| Immunofluorescence (IF)/ICC | IF/ICC : 1:20-1:100 |
| Tested Reactivity | human, mouse, rat, pig |
| Cited Reactivity | human, mouse, zebrafish |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen | CatNo: Ag5503 Product name: Recombinant human NR2E3 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-322 aa of BC041421 Sequence: MCPVDKAHRNQCQACRLKKCLQAGMNQDAVQNERQPRSTAQVHLDSMESNTESRPESLVAPPAPAGRSPRGPTPMSAARALGHHFMASLITAETCAKLEPEDADENIDVTSNDPEFPSSPYSSSSPCGLDSIHETSARLLFMAVKWAKNLPVFSSLPFRDQVILLEEAWSELFLLGAIQWSLPLDSCPLLAPPEASAAGGAQGRLTLASMETRVLQETISRFRALAVDPTEFACMKALVLFKPETRGLKDPEHVEALQDQSQVMLSQHSKAHHPSQPVRFGKLLLLLPSLRFITAERIELLFFRKTIGNTPMEKLLCDMFKN Predict reactive species |
| Full Name | nuclear receptor subfamily 2, group E, member 3 |
| Calculated Molecular Weight | 45 kDa |
| Observed Molecular Weight | 43-45 kDa |
| GenBank Accession Number | BC041421 |
| Gene Symbol | NR2E3 |
| Gene ID (NCBI) | 10002 |
| RRID | AB_2155476 |
| Conjugate | Unconjugated |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | Q9Y5X4 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA. |
| IHC protocol for NR2E3 antibody 14246-1-AP | Download protocol |
| WB protocol for NR2E3 antibody 14246-1-AP | Download protocol |
| mouse | WB FASEB J NR2E3 is a key component in p53 activation by regulating a long noncoding RNA DINO in acute liver injuries. Authors - Tilak Khanal KO Validated View Article |
| human | WB Adv Sci (Weinh) The Loss of an Orphan Nuclear Receptor NR2E3 Augments Wnt/β-catenin Signaling via Epigenetic Dysregulation that Enhances Sp1-β catenin-p300 Interactions in Hepatocellular Carcinoma Authors - Yuet-Kin Leung KO Validated View Article |
| zebrafish | IHC Am J Pathol Dysregulation of Spliceosomes Complex Induces Retinitis Pigmentosa-Like Characteristics in sf3b4-Depleted Zebrafish Authors - Zulvikar Syambani Ulhaq View Article |
| Citations | 10 |
| Dilutions | WB : 1:2000-1:12000 IHC : 1:20-1:200 IF/ICC : 1:20-1:100 |
| Isotype | IgG |
| Clonality | Polyclonal |
| Clone Number | - |
| Conjugation | Unconjugated |
NR2E3, also known as PNR, encodes a retinal nuclear receptor that is a ligand-dependent transcription factor. This protein is part of a large family of nuclear receptor transcription factors involved in signaling pathways. NR2E3 influences the development of photoreceptors and their differentiation into rod and cone types, and acts as a ranscriptional factor that is an activator of rod development and repressor of cone development [PMID:20725840]. It binds the promoter region of a number of rod- and cone-specific genes, including rhodopsin, M- and S-opsin and rod-specific phosphodiesterase beta subunit. [PMID:15689355] Protocols Product Specific Protocols IHC protocol for NR2E3 antibody 14246-1-AP Download protocol WB protocol for NR2E3 antibody 14246-1-AP Download protocol Standard Protocols Click here to view our Standard Protocols
Publications
- Distinct and Atypical Intrinsic and Extrinsic Cell Death Pathways between Photoreceptor Cell Types upon Specific Ablation of Ranbp2 in Cone Photoreceptors.
Journal: PLoS Genet | Authors: Cho Kyoung-In KI | Species: mouse | Application: IHC - Differential Loss of Prolyl-Isomerase or Chaperone Activity of Ran-binding protein 2 (Ranbp2) Unveils Distinct Physiological Roles of Its Cyclophilin Domain in Proteostasis.
Journal: J Biol Chem | Authors: Kyoung-In Cho | Species: mouse | Application: WB - Loss of NR2E3 represses AHR by LSD1 reprogramming, is associated with poor prognosis in liver cancer.
Journal: Sci Rep | Authors: Tilak Khanal | Species: human | Application: WB - NR2E3 is a key component in p53 activation by regulating a long noncoding RNA DINO in acute liver injuries.
Journal: FASEB J | Authors: Tilak Khanal KO Validated | Species: mouse | Application: WB - The Loss of an Orphan Nuclear Receptor NR2E3 Augments Wnt/β-catenin Signaling via Epigenetic Dysregulation that Enhances Sp1-β catenin-p300 Interactions in Hepatocellular Carcinoma
Journal: Adv Sci (Weinh) | Authors: Yuet-Kin Leung KO Validated | Species: human | Application: WB - Dysregulation of Spliceosomes Complex Induces Retinitis Pigmentosa-Like Characteristics in sf3b4-Depleted Zebrafish
Journal: Am J Pathol | Authors: Zulvikar Syambani Ulhaq | Species: zebrafish | Application: IHC - Differential Loss of Prolyl-Isomerase or Chaperone Activity of Ran-binding protein 2 (Ranbp2) Unveils Distinct Physiological Roles of Its Cyclophilin Domain in Proteostasis.
Journal: J Biol Chem | Authors: Kyoung-In Cho | Species: mouse | Application: WB - Distinct and Atypical Intrinsic and Extrinsic Cell Death Pathways between Photoreceptor Cell Types upon Specific Ablation of Ranbp2 in Cone Photoreceptors.
Journal: PLoS Genet | Authors: Cho Kyoung-In KI | Species: mouse | Application: IHC - Regulation of the stem‑like properties of estrogen receptor‑positive breast cancer cells through NR2E3/NR2C2 signaling
Journal: Exp Ther Med | Authors: Shanglun Xie | Species: Human - Low expression of NR1D1 and NR2E3 is associated with advanced features of retinoblastoma
Journal: Int Ophthalmol | Authors: Jie Ding | Species: human | Application: IHC
Reviews
Write Your Own Review
Related Products
Check items to add to the cart or
