NRG1 Recombinant monoclonal antibody, PBS Only (Capture) 83251-4-PBS proteintech
$699.00
In stock
SKU
83251-4-PBS
| Catalog Number | 83251-4-PBS |
| Synonyms | NRG1A, ARIA, GGF, GGF2, Glial growth factor |
| Host | Rabbit |
| Reactivity | human |
| Form | Liquid |
| Formulation | PBS Only |
| Applications | Sandwich ELISA, Indirect ELISA, Sample test |
| Host / Isotype | Rabbit / IgG |
| Tested Reactivity | human |
| Class | Recombinant |
| Type | Antibody |
| Immunogen | CatNo: Ag35114 Product name: Recombinant human NRG1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 177-241 aa of BC007675 Sequence: SHLVKCAEKEKTFCVNGGECFMVKDLSNPSRYLCKCQPGFTGARCTENVPMKVQNQEKAEELYQK Predict reactive species |
| Full Name | neuregulin 1 |
| Calculated Molecular Weight | 70 kDa |
| GenBank Accession Number | BC007675 |
| Gene Symbol | NRG1 |
| Gene ID (NCBI) | 3084 |
| Conjugate | Unconjugated |
| Purification Method | Protein A purification |
| UNIPROT ID | Q02297 |
| Storage Buffer | PBS only, pH 7.3. |
| Storage Conditions | Store at -80°C. |
| Citations | - |
| Isotype | IgG |
| Clonality | Recombinant |
| Clone Number | 240067D3 |
| Conjugation | Unconjugated |
Reviews
Write Your Own Review
Related Products
Check items to add to the cart or
