ABLIM2 Recombinant monoclonal antibody, PBS Only (Detector) 84177-1-PBS proteintech
$699.00
In stock
SKU
84177-1-PBS
| Catalog Number | 84177-1-PBS |
| Synonyms | abLIM-2, Actin binding LIM protein 2, Actin-binding LIM protein 2, Actin-binding LIM protein family member 2, KIAA1808 |
| Host | Rabbit |
| Reactivity | human |
| Form | Liquid |
| Formulation | PBS Only |
| Applications | Cytometric bead array, Indirect ELISA |
| Host / Isotype | Rabbit / IgG |
| Tested Reactivity | human |
| Class | Recombinant |
| Type | Antibody |
| Immunogen | CatNo: Ag18198 Product name: Recombinant human ABLIM2 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 282-389 aa of BC122567 Sequence: SIISVPASSTSGSPSRVIYAKLGGEILDYRDLAALPKSKAIYDIDRPDMISYSPYISHSAGDRQSYGEGDQDDRSYKQCRTSSPSSTGSVSLGRYTPTSRSPQHYSRP Predict reactive species |
| Full Name | actin binding LIM protein family, member 2 |
| Calculated Molecular Weight | 611 aa, 68 kDa |
| GenBank Accession Number | BC122567 |
| Gene Symbol | ABLIM2 |
| Gene ID (NCBI) | 84448 |
| Conjugate | Unconjugated |
| Purification Method | Protein A purification |
| UNIPROT ID | Q6H8Q1 |
| Storage Buffer | PBS only, pH 7.3. |
| Storage Conditions | Store at -80°C. |
| Citations | - |
| Isotype | IgG |
| Clonality | Recombinant |
| Clone Number | 241450B12 |
| Conjugation | Unconjugated |
Reviews
Write Your Own Review
Related Products
Check items to add to the cart or
