NUP153 Polyclonal antibody 14189-1-AP proteintech
$149.00
In stock
SKU
14189-1-AP
| Catalog Number | 14189-1-AP |
| Synonyms | 153 kDa nucleoporin, HNUP153, N153, nucleoporin 153kDa, Nucleoporin Nup153, NUP153 |
| Host | Rabbit |
| Reactivity | human, mouse, rat and More (1) |
| Reactivity | human, mouse, rat, pig |
| Form | Liquid |
| Formulation | PBS, Azide, Glycerol |
| Applications | WB, IHC, IP, ELISA |
| Applications | WB, IP, ELISA |
| Host / Isotype | Rabbit / IgG |
| Tested Applications — Positive WB detected in | K-562 cells, HeLa cells, A431 cells, HepG2 cells, MCF-7 cells |
| Tested Applications — Positive IP detected in | K-562 cells |
| Recommended Dilutions — Western Blot (WB) | WB : 1:500-1:2400 |
| Recommended Dilutions — Immunoprecipitation (IP) | IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate |
| Positive WB detected in | K-562 cells, HeLa cells, A431 cells, HepG2 cells, MCF-7 cells |
| Positive IP detected in | K-562 cells |
| Western Blot (WB) | WB : 1:500-1:2400 |
| Immunoprecipitation (IP) | IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate |
| Tested Reactivity | human, mouse, rat |
| Cited Reactivity | human, mouse, pig |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen | CatNo: Ag5519 Product name: Recombinant human NUP153 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1125-1475 aa of BC052965 Sequence: EEPKCQPVFSFGNSEQTKDENSSKSTFSFSMTKPSEKESEQPAKATFAFGAQTSTTADQGAAKPVFSFLNNSSSSSSTPATSAGGGIFGSSTSSSNPPVATFVFGQSSNPVSSSAFGNTAESSTSQSLLFSQDSKLATTSSTGTAVTPFVFGPGASSNNTTTSGFGFGATTTSSSAGSSFVFGTGPSAPSASPAFGANQTPTFGQSQGASQPNPPGFGSISSSTALFPTGSQPAPPTFGTVSSSSQPPVFGQQPSQSAFGSGTTPNSSSAFQFGSSTTNFNFTNNSPSGVFTFGANSSTPAASAQPSGSGGFPFNQSPAAFTVGSNGKNVFSSSGTSFSGRKIKTAVRRRK Predict reactive species |
| Full Name | nucleoporin 153kDa |
| Calculated Molecular Weight | 154 kDa |
| Observed Molecular Weight | 154 kDa |
| GenBank Accession Number | BC052965 |
| Gene Symbol | NUP153 |
| Gene ID (NCBI) | 9972 |
| RRID | AB_2154463 |
| Conjugate | Unconjugated |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | P49790 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA. |
| IP protocol for NUP153 antibody 14189-1-AP | Download protocol |
| WB protocol for NUP153 antibody 14189-1-AP | Download protocol |
| Mouse | Nat Commun BOOST: a robust ten-fold expansion method on hour-scale Authors - Jinyu Guo View Article |
| human | WB J Med Virol Novel Function of NUP153 in HNF4α Transcriptional Upregulation Contributes to Promoting HBV Replication Authors - Qianqian Jiang View Article |
| pig | WB Int J Biol Macromol Subcellular proteomics reveals the crosstalk between nucleocytoplasmic trafficking and the innate immune response to Senecavirus A infection Authors - Mingyang Li View Article |
| Citations | 8 |
| Dilutions | WB : 1:500-1:2400 IP : 0.5-4.0 ug for IP and 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate for WB |
| Isotype | IgG |
| Clonality | Polyclonal |
| Clone Number | - |
| Conjugation | Unconjugated |
NUP153 is an FG-repeat containing NUP, contains a high-affinity site for importin-β, localizes on the nucleoplasmic face of the nuclear pore and is required for assembly of the nuclear basket and import of a subset of nuclear proteins [PMID:18845677]. NUP153 also facilitates nuclear export of mRNA and ribonucleoprotein particles and may have additional functions within the nucleus [PMID:16195343]. The 53BP1-NUP153/importin-β pathway as an important aspect of the DDR network add to an emerging evidence of subcellular trafficking as an integral part of genome surveillance [PMID:22075984]. Protocols Product Specific Protocols IP protocol for NUP153 antibody 14189-1-AP Download protocol WB protocol for NUP153 antibody 14189-1-AP Download protocol Standard Protocols Click here to view our Standard Protocols
Publications
- BOOST: a robust ten-fold expansion method on hour-scale
Journal: Nat Commun | Authors: Jinyu Guo | Species: Mouse - Ascites circRNA ASCOR Drives Platinum Resistance of High-Grade Serous Ovarian Cancer by Facilitating RPA1 Nuclear Translocation.
Journal: Adv Sci (Weinh) | Authors: Hanyuan Liu | Species: human | Application: WB - Exon junction complex and nuclear pore complex components preferentially govern the nuclear export of spliced lncRNAs.
Journal: Cell Death Discov | Authors: Sondas Saeed - Subcellular proteomics reveals the crosstalk between nucleocytoplasmic trafficking and the innate immune response to Senecavirus A infection
Journal: Int J Biol Macromol | Authors: Mingyang Li | Species: pig | Application: WB - The functional and clinical significance of nucleoporin NUP153 across human cancers: a systematic study based on multi-omics analysis and bench work validation
Journal: Front Immunol | Authors: Youfu He | Species: human | Application: IHC - Novel Function of NUP153 in HNF4α Transcriptional Upregulation Contributes to Promoting HBV Replication
Journal: J Med Virol | Authors: Qianqian Jiang | Species: human | Application: WB
Reviews
Write Your Own Review
Related Products
Check items to add to the cart or
