ABR Recombinant monoclonal antibody, PBS Only 84011-6-PBS proteintech
$699.00
In stock
SKU
84011-6-PBS
| Catalog Number | 84011-6-PBS |
| Synonyms | MDB, active BCR related gene, 241121G1 |
| Host | Rabbit |
| Reactivity | human, mouse, rat |
| Form | Liquid |
| Formulation | PBS Only |
| Applications | WB, Indirect ELISA |
| Host / Isotype | Rabbit / IgG |
| Tested Reactivity | human, mouse, rat |
| Class | Recombinant |
| Type | Antibody |
| Immunogen | CatNo: Ag29522 Product name: Recombinant human ABR protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-87 aa of NM_021962 Sequence: MEPLSHRGLPRLSWIDTLYSNFSYGTDEYDGEGNEEQKGPPEGSETMPYIDESPTMSPQLSARSQGGGDGVSPTPPEGLAPGVEAGK Predict reactive species |
| Full Name | active BCR-related gene |
| Calculated Molecular Weight | 98 kDa |
| Observed Molecular Weight | 97-100 kDa |
| GenBank Accession Number | NM_021962 |
| Gene Symbol | ABR |
| Gene ID (NCBI) | 29 |
| RRID | AB_3743513 |
| Conjugate | Unconjugated |
| Purification Method | Protein A purfication |
| UNIPROT ID | Q12979 |
| Storage Buffer | PBS only, pH 7.3. |
| Storage Conditions | Store at -80°C. |
| Citations | - |
| Isotype | IgG |
| Clonality | Recombinant |
| Clone Number | 241121G1 |
| Conjugation | Unconjugated |
ABR (Active breakpoint cluster region-related protein) is the only protein known in humans and mice to share high homology with BCR (68% amino acid identity). BCR(Breakpoint cluster region) gene was originally identified due to its involvement in a specific chromosomal translocation that causes the development of chronic myeloid leukemia and a subset of acute lymphoblastic leukemia. The C-terminus is a GTPase-activating protein domain which stimulates GTP hydrolysis by RAC1, RAC2 and CDC42. (PMID: 17116687, PMID: 37507586)
Reviews
Write Your Own Review
Related Products
Check items to add to the cart or
