Neurofibromin Recombinant monoclonal antibody, PBS Only (Capture) 83620-2-PBS proteintech
$699.00
In stock
SKU
83620-2-PBS
| Catalog Number | 83620-2-PBS |
| Synonyms | NF1, neurofibromin 1, NF 1, NF-1 |
| Host | Rabbit |
| Reactivity | human |
| Form | Liquid |
| Formulation | PBS Only |
| Applications | Cytometric bead array, Indirect ELISA |
| Host / Isotype | Rabbit / IgG |
| Tested Reactivity | human |
| Class | Recombinant |
| Type | Antibody |
| Immunogen | CatNo: Ag25799 Product name: Recombinant human Neurofibromin protein Source: e coli. -derived, PET30a Tag: 6*His Domain: 1-100 aa of M60915 Sequence: MAAHRPVEWVQAVVSRFDEQLPIKTGQQNTHTKVSTEHNKECLINISKYKFSLVISGLTTILKNVNNMRIFGEAAEKNLYLSQLIILDTLEKCLAGQPKD Predict reactive species |
| Full Name | neurofibromin 1 |
| Calculated Molecular Weight | 319 kDa |
| GenBank Accession Number | M60915 |
| Gene Symbol | Neurofibromin 1 |
| Gene ID (NCBI) | 4763 |
| Conjugate | Unconjugated |
| Purification Method | Protein A purification |
| UNIPROT ID | P21359 |
| Storage Buffer | PBS only, pH 7.3. |
| Storage Conditions | Store at -80°C. |
| Citations | - |
| Isotype | IgG |
| Clonality | Recombinant |
| Clone Number | 240540C4 |
| Conjugation | Unconjugated |
Reviews
Write Your Own Review
Related Products
Check items to add to the cart or
