OPN1MW Polyclonal antibody 30975-1-AP proteintech
$149.00
In stock
SKU
30975-1-AP
| Catalog Number | 30975-1-AP |
| Synonyms | Green-sensitive opsin, Green sensitive opsin, GOP, GCP |
| Host | Rabbit |
| Reactivity | human, mouse, rat |
| Form | Liquid |
| Formulation | PBS, Azide, Glycerol |
| Applications | WB, ELISA |
| Host / Isotype | Rabbit / IgG |
| Tested Applications — Positive WB detected in | mouse brain tissue, rat brain tissue |
| Recommended Dilutions — Western Blot (WB) | WB : 1:500-1:2000 |
| Positive WB detected in | mouse brain tissue, rat brain tissue |
| Western Blot (WB) | WB : 1:500-1:2000 |
| Tested Reactivity | human, mouse, rat |
| Cited Reactivity | mouse |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen | CatNo: Ag34169 Product name: Recombinant human OPN1MW protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-52 aa of BC156776 Sequence: MAQQWSLQRLAGRHPQDSYEDSTQSSIFTYTNSNSTRGPFEGPNYHIAPRWV Predict reactive species |
| Full Name | opsin 1 (cone pigments), medium-wave-sensitive |
| Observed Molecular Weight | 38-40 kDa |
| GenBank Accession Number | BC156776 |
| Gene Symbol | OPN1MW |
| Gene ID (NCBI) | 2652 |
| RRID | AB_3669801 |
| Conjugate | Unconjugated |
| Purification Method | Antigen affinity Purification |
| UNIPROT ID | P04001 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA. |
| WB protocol for OPN1MW antibody 30975-1-AP | Download protocol |
| mouse | WB Exp Eye Res Deferiprone protects photoreceptors by inhibiting ferroptosis after experimental retinal detachment Authors - Ziyang Ye View Article |
| Christoffer (Verified Customer) (02-19-2025) | The antibody works well on both cryosections and paraffin-embedded tissues. However, for optimal results, antigen retrieval is recommended for cryosections as well. Citrate buffer antigen retrieval method was used. Applications: Immunohistochemistry, Immunofluorescence Primary Antibody Dilution: 1/500 Cell Tissue Type: Adult mouse retina / cone photoreceptor cells, |
| Citations | 1 |
| Dilutions | WB : 1:500-1:2000 |
| Isotype | IgG |
| Clonality | Polyclonal |
| Clone Number | - |
| Conjugation | Unconjugated |
OPN1MW (opsin 1, medium wave sensitive), also known as CBD. It is expected to be located in cell membrane. This gene encodes for a light absorbing visual pigment of the opsin gene family. The encoded protein is called green cone photopigment or medium-wavelength sensitive opsin. Opsins are G-protein coupled receptors with seven transmembrane domains, an N-terminal extracellular domain, and a C-terminal cytoplasmic domain. The long-wavelength opsin gene and multiple copies of the medium-wavelength opsin gene are tandemly arrayed on the X chromosome and frequent unequal recombination and gene conversion may occur between these sequences. X chromosomes may have fusions of the medium- and long-wavelength opsin genes or may have more than one copy of these genes. Defects in this gene are the cause of deutanopic colorblindness. The calculated molecular weight of OPN1MW is 40 kDa. Protocols Product Specific Protocols WB protocol for OPN1MW antibody 30975-1-AP Download protocol Standard Protocols Click here to view our Standard Protocols
Publications
- Deferiprone protects photoreceptors by inhibiting ferroptosis after experimental retinal detachment
Journal: Exp Eye Res | Authors: Ziyang Ye | Species: mouse | Application: WB
Product Documents
Reviews
Write Your Own Review
Related Products
Check items to add to the cart or
