OPN1SW Recombinant monoclonal antibody, PBS Only (Capture) 83754-2-PBS proteintech
$699.00
In stock
SKU
83754-2-PBS
| Catalog Number | 83754-2-PBS |
| Synonyms | Blue sensitive opsin, Blue-sensitive opsin, BOP, CBT, Short-wave-sensitive opsin 1 |
| Host | Rabbit |
| Reactivity | human |
| Form | Liquid |
| Formulation | PBS Only |
| Applications | Cytometric bead array, Indirect ELISA |
| Host / Isotype | Rabbit / IgG |
| Tested Reactivity | human |
| Class | Recombinant |
| Type | Antibody |
| Immunogen | CatNo: Ag20445 Product name: Recombinant human OPN1SW protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 265-348 aa of BC156719 Sequence: YAAFAMYMVNNRNHGLDLRLVTIPSFFSKSACIYNPIIYCFMNKQFQACIMKMVCGKAMTDESDTCSSQKTEVSTVSSTQVGPN Predict reactive species |
| Full Name | opsin 1 (cone pigments), short-wave-sensitive |
| Calculated Molecular Weight | 348 aa, 39 kDa |
| GenBank Accession Number | BC156719 |
| Gene Symbol | OPN1SW |
| Gene ID (NCBI) | 611 |
| Conjugate | Unconjugated |
| Purification Method | Protein A purification |
| UNIPROT ID | P03999 |
| Storage Buffer | PBS only, pH 7.3. |
| Storage Conditions | Store at -80°C. |
| Citations | - |
| Isotype | IgG |
| Clonality | Recombinant |
| Clone Number | 240714H5 |
| Conjugation | Unconjugated |
Reviews
Write Your Own Review
Related Products
Check items to add to the cart or
