ORAI3 Recombinant monoclonal antibody, PBS Only (Detector) 84340-2-PBS proteintech
$699.00
In stock
SKU
84340-2-PBS
| Catalog Number | 84340-2-PBS |
| Synonyms | Transmembrane protein 142C, TMEM142C, Protein orai-3, 241568A2 |
| Host | Rabbit |
| Reactivity | human |
| Form | Liquid |
| Formulation | PBS Only |
| Applications | WB, IF/ICC, Cytometric bead array, Indirect ELISA |
| Host / Isotype | Rabbit / IgG |
| Tested Reactivity | human |
| Class | Recombinant |
| Type | Antibody |
| Immunogen | CatNo: Ag36135 Product name: Recombinant human ORAI3 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-100 aa of BC006126 Sequence: MKGGEGDAGEQAPLNPEGESPAGSATYREFVHRGYLDLMGASQHSLRALSWRRLYLSRAKLKASSRTSALLSGFAMVAMVEVQLESDHEYPPGLLVAFSA Predict reactive species |
| Full Name | ORAI calcium release-activated calcium modulator 3 |
| Calculated Molecular Weight | 295 aa, 32 kDa |
| Observed Molecular Weight | ~30 kDa，~60 kDa |
| GenBank Accession Number | BC006126 |
| Gene Symbol | ORAI3 |
| Gene ID (NCBI) | 93129 |
| RRID | AB_3671881 |
| Conjugate | Unconjugated |
| Purification Method | Protein A purification |
| UNIPROT ID | Q9BRQ5 |
| Storage Buffer | PBS only, pH 7.3. |
| Storage Conditions | Store at -80°C. |
| Citations | - |
| Isotype | IgG |
| Clonality | Recombinant |
| Clone Number | 241568A2 |
| Conjugation | Unconjugated |
ORAI3, also named TMEM142C, is a key regulator or component of store-operated Ca2+ channels and transcription factor NFAT nuclear import. ORAI3 channels appeared to differ from Orai1 and -2 in being somewhat resistant to Ca2+ depotentiation. The molecular weight of monomers and dimers for Orai3 is about 30-35 kDa and 60-70 kDa (PMID: 20971921; 17293345; 22580508).
Reviews
Write Your Own Review
Related Products
Check items to add to the cart or
