OSTbeta/SLC51B Polyclonal antibody 21248-1-AP proteintech
$149.00
In stock
SKU
21248-1-AP
| Catalog Number | 21248-1-AP |
| Synonyms | OSTbeta / SLC51B, OSTbeta, OST beta, OSTB, OST-beta |
| Host | Rabbit |
| Reactivity | human and More (2) |
| Reactivity | human, mouse, rat |
| Form | Liquid |
| Formulation | PBS, Azide, Glycerol |
| Applications | WB, IHC, ELISA |
| Applications | IHC, ELISA |
| Host / Isotype | Rabbit / IgG |
| Tested Applications — Positive IHC detected in | human small intestine tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
| Recommended Dilutions — Immunohistochemistry (IHC) | IHC : 1:50-1:500 |
| Positive IHC detected in | human small intestine tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
| Immunohistochemistry (IHC) | IHC : 1:50-1:500 |
| Tested Reactivity | human |
| Cited Reactivity | mouse, rat |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen | CatNo: Ag15751 Product name: Recombinant human OSTbeta protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-128 aa of BC103842 Sequence: MEHSEGAPGDPAGTVVPQELLEEMLWFFRVEDASPWNHSILALAAVVVIISMVLLGRSIQASRKEKMQPPEKETPEVLHLDEAKDHNSLNNLRETLLSEKPNLAQVELELKERDVLSVFLPDVPETES Predict reactive species |
| Full Name | organic solute transporter beta |
| Calculated Molecular Weight | 128 aa, 14 kDa |
| GenBank Accession Number | BC103842 |
| Gene Symbol | SLC51B |
| Gene ID (NCBI) | 123264 |
| RRID | AB_3085647 |
| Conjugate | Unconjugated |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | Q86UW2 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA. |
| IHC protocol for OSTbeta/SLC51B antibody 21248-1-AP | Download protocol |
| mouse | WB J Ethnopharmacol Sub-chronic realgar exposure causes liver inflammatory injury in mice by inducing bile acid-mediated NLRP3 inflammasome activation through down-regulation of ileal FXR Authors - Guangyan Li View Article |
| rat | WB J Ethnopharmacol Cortex Dictamni induces cholestatic liver injury via the bile acid-gut-liver axis mediated by FXR signaling pathway in rats Authors - Xiaomin Xu View Article |
| Citations | 2 |
| Dilutions | IHC : 1:50-1:500 |
| Isotype | IgG |
| Clonality | Polyclonal |
| Clone Number | - |
| Conjugation | Unconjugated |
Organic solute transporter alpha-beta (Ostα-Ostβ) is a heteromeric transporter that has been localized to the basolateral membrane of epithelial cells of the small intestine, kidney and liver, and appears to be essential for bile acid homeostasis. The transporter is composed of a predicted 340-amino acid, 7-transmembrane domain protein (Ostα) and a putative 128-amino acid, single-transmembrane domain polypeptide (Ostβ). Ostα-Ostβ transports bile acids by a facilitated diffusion mechanism; therefore, Ostα-Ostβ can mediate cellular efflux or uptake depending on the substrate's electrochemical gradient. It's reported that Ostα-Ostβ is not only essential for bile acid, but also vital for sterol disposition and enterohepatic circulation(PMID: 21691099). Protocols Product Specific Protocols IHC protocol for OSTbeta/SLC51B antibody 21248-1-AP Download protocol Standard Protocols Click here to view our Standard Protocols
Publications
- Sub-chronic realgar exposure causes liver inflammatory injury in mice by inducing bile acid-mediated NLRP3 inflammasome activation through down-regulation of ileal FXR
Journal: J Ethnopharmacol | Authors: Guangyan Li | Species: mouse | Application: WB - Cortex Dictamni induces cholestatic liver injury via the bile acid-gut-liver axis mediated by FXR signaling pathway in rats
Journal: J Ethnopharmacol | Authors: Xiaomin Xu | Species: rat | Application: WB
Product Documents
Reviews
Write Your Own Review
Related Products
Check items to add to the cart or
