OX40L/TNFSF4 Recombinant monoclonal antibody, PBS Only 82794-7-PBS proteintech
$699.00
In stock
SKU
82794-7-PBS
| Catalog Number | 82794-7-PBS |
| Synonyms | OX40L, TNFSF4, TNFSF4/CD252, 241813A6, OX 40L |
| Host | Rabbit |
| Reactivity | human |
| Form | Liquid |
| Formulation | PBS Only |
| Applications | WB, IHC, IF/ICC, FC, Indirect ELISA |
| Host / Isotype | Rabbit / IgG |
| Tested Reactivity | human |
| Class | Recombinant |
| Type | Antibody |
| Immunogen | CatNo: Eg0582 Product name: Recombinant Human OX40L/TNFSF4 protein (His Tag) Source: mammalian cells -derived, pCDNA3.4-IGSF8(C6) Tag: N-6*His Domain: 51-183 aa of NM_003326.5 Sequence: QVSHRYPRIQSIKVQFTEYKKEKGFILTSQKEDEIMKVQNNSVIINCDGFYLISLKGYFSQEVNISLHYQKDEEPLFQLKKVRSVNSLMVASLTYKDKVYLNVTTDNTSLDDFHVNGGELILIHQNPGEFCVL Predict reactive species |
| Full Name | tumor necrosis factor (ligand) superfamily, member 4 |
| Observed Molecular Weight | 30 kDa |
| GenBank Accession Number | NM_003326.5 |
| Gene Symbol | OX40L/TNFSF4 |
| Gene ID (NCBI) | 7292 |
| RRID | AB_3670552 |
| Conjugate | Unconjugated |
| Purification Method | Protein A purfication |
| UNIPROT ID | P23510 |
| Storage Buffer | PBS only, pH 7.3. |
| Storage Conditions | Store at -80°C. |
| Citations | - |
| Isotype | IgG |
| Clonality | Recombinant |
| Clone Number | 241813A6 |
| Conjugation | Unconjugated |
Reviews
Write Your Own Review
Related Products
Check items to add to the cart or
