Osteocalcin Recombinant monoclonal antibody, PBS Only (Detector) 80551-3-PBS proteintech
$699.00
In stock
SKU
80551-3-PBS
| Catalog Number | 80551-3-PBS |
| Synonyms | BGLAP, BGP, Bone Gla protein, Gamma-carboxyglutamic acid-containing protein |
| Host | Rabbit |
| Reactivity | human |
| Form | Liquid |
| Formulation | PBS Only |
| Applications | Sandwich ELISA, Indirect ELISA |
| Host / Isotype | Rabbit / IgG |
| Tested Reactivity | human |
| Class | Recombinant |
| Type | Antibody |
| Immunogen | CatNo: Ag20065 Product name: Recombinant human Osteocalcin protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 24-100 aa of BC113432 Sequence: KPSGAESSKGAAFVSKQEGSEVVKRPRRYLYQWLGAPVPYPDPLEPRREVCELNPDCDELADHIGFQEAYRRFYGPV Predict reactive species |
| Full Name | bone gamma-carboxyglutamate (gla) protein |
| Calculated Molecular Weight | 100 aa, 11 kDa |
| GenBank Accession Number | BC113432 |
| Gene Symbol | Osteocalcin |
| Gene ID (NCBI) | 632 |
| Conjugate | Unconjugated |
| Purification Method | Protein A purification |
| UNIPROT ID | P02818 |
| Storage Buffer | PBS only, pH 7.3. |
| Storage Conditions | Store at -80°C. |
| Citations | - |
| Isotype | IgG |
| Clonality | Recombinant |
| Clone Number | 250224H8 |
| Conjugation | Unconjugated |
Reviews
Write Your Own Review
Related Products
Check items to add to the cart or
