P2RX7 Polyclonal antibody 11144-1-AP proteintech
$149.00
In stock
SKU
11144-1-AP
| Catalog Number | 11144-1-AP |
| Synonyms | P2X7, Purinergic receptor |
| Host | Rabbit |
| Reactivity | human, mouse, rat |
| Form | Liquid |
| Formulation | PBS, Azide, Glycerol |
| Applications | WB, IHC, IF, FC (Intra), ELISA |
| Applications | WB, FC (Intra), ELISA |
| Host / Isotype | Rabbit / IgG |
| Tested Applications — Positive WB detected in | mouse brain tissue, mouse cerebellum tissue |
| Tested Applications — Positive FC (Intra) detected in | RAW 264.7 cells |
| Recommended Dilutions — Western Blot (WB) | WB : 1:1000-1:6000 |
| Recommended Dilutions — Flow Cytometry (FC) (INTRA) | FC (INTRA) : 0.50 ug per 10^6 cells in a 100 µl suspension |
| Positive WB detected in | mouse brain tissue, mouse cerebellum tissue |
| Positive FC (Intra) detected in | RAW 264.7 cells |
| Western Blot (WB) | WB : 1:1000-1:6000 |
| Flow Cytometry (FC) (INTRA) | FC (INTRA) : 0.50 ug per 10^6 cells in a 100 µl suspension |
| Tested Reactivity | human, mouse, rat |
| Cited Reactivity | human, mouse, rat |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen | CatNo: Ag1600 Product name: Recombinant human P2RX7 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 246-595 aa of BC011913 Sequence: AIQGGIMGIEIYWDCNLDRWFHHCHPKYSFRRLDDKTTNVSLYPGYNFRYAKYYKENNVEKRTLIKVFGIRFDILVFGTGGKFDIIQLVVYIGSTLSYFGLAAVFIDFLIDTYSSNCCRSHIYPWCKCCQPCVVNEYYYRKKCESIVEPKPTLKYVSFVDESHIRMVNQQLLGRSLQDVKGQEVPRPAMDFTDLSRLPLALHDTPPIPGQPEEIQLLRKEATPRSRDSPVWCQCGSCLPSQLPESHRCLEELCCRKKPGACITTSELFRKLVLSRHVLQFLLLYQEPLLALDVDSTNSRLRHCAYRCYATWRFGSQDMADFAILPSCCRWRIRKEFPKSEGQYSGFKSPY Predict reactive species |
| Full Name | purinergic receptor P2X, ligand-gated ion channel, 7 |
| Calculated Molecular Weight | 69 kDa |
| Observed Molecular Weight | 70-80 kDa |
| GenBank Accession Number | BC011913 |
| Gene Symbol | P2RX7 |
| Gene ID (NCBI) | 5027 |
| RRID | AB_2158371 |
| Conjugate | Unconjugated |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | Q99572 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA. |
| FC protocol for P2RX7 antibody 11144-1-AP | Download protocol |
| WB protocol for P2RX7 antibody 11144-1-AP | Download protocol |
| human | IF J Exp Clin Cancer Res Shock wave-induced ATP release from osteosarcoma U2OS cells promotes cellular uptake and cytotoxicity of methotrexate. Authors - Baochang Qi View Article |
| mouse | WB Front Cell Neurosci Clemastine Alleviates Depressive-Like Behavior Through Reversing the Imbalance of Microglia-Related Pro-inflammatory State in Mouse Hippocampus. Authors - Wen-Jun Su View Article |
| rat | WB Food Sci Nutr Protective Effect of Silymarin Against Paclitaxel-Induced Cardiotoxicity. Authors - Tuğçe Tutar View Article |
| Citations | 30 |
| Dilutions | WB : 1:1000-1:6000 FC (INTRA) : 0.50 ug per 10^6 cells in a 100 µl suspension |
| Isotype | IgG |
| Clonality | Polyclonal |
| Clone Number | - |
| Conjugation | Unconjugated |
Nucleotides, the structural subunits of the nucleic acids, are also important extracellular signaling molecules. P2 receptors are a family of cell surface receptors that mediate a wide variety of physiologic effects in response to extracellular nucleotides. These receptors fall into two classes: P2X receptors, which are ligand-gated ion channels that mediate calcium and potassium fluxes in response to ATP, and P2Y receptors, which are G protein-coupled receptors (GPCRs) (PMID: 21724990). P2RX7 functions as a ligand-gated ion channel and is responsible for ATP-dependent lysis of macrophages through the formation of membrane pores permeable to large molecules. P2RX7 is highly expressed by cells of the haemopoietic lineage and can mediate cell death, killing of infectious organisms, and regulation of the inflammatory response (PMID: 22102807). Protocols Product Specific Protocols FC protocol for P2RX7 antibody 11144-1-AP Download protocol WB protocol for P2RX7 antibody 11144-1-AP Download protocol Standard Protocols Click here to view our Standard Protocols
Publications
- The danger signal, extracellular ATP, is a sensor for an airborne allergen and triggers IL-33 release and innate Th2-type responses.
Journal: J Immunol | Authors: Kouzaki Hideaki H | Species: human | Application: IF - Clemastine Alleviates Depressive-Like Behavior Through Reversing the Imbalance of Microglia-Related Pro-inflammatory State in Mouse Hippocampus.
Journal: Front Cell Neurosci | Authors: Wen-Jun Su | Species: mouse | Application: WB - HMG-CoA reductase inhibitors activate caspase-1 in human monocytes depending on ATP release and P2X7 activation.
Journal: J Leukoc Biol | Authors: Liao Yi-Hsiang YH - Astaxanthin Alleviates Lung Injury by Regulating Oxidative Stress, Inflammatory Response, P2X7 Receptor, NF-κB, Bcl-2, and Caspase-3 in LPS-Induced Endotoxemia
Journal: Environ Toxicol | Authors: Seckin Ozkanlar | Species: rat | Application: WB,IHC - Shock wave-induced ATP release from osteosarcoma U2OS cells promotes cellular uptake and cytotoxicity of methotrexate.
Journal: J Exp Clin Cancer Res | Authors: Baochang Qi | Species: human | Application: IF - Protective Effect of Silymarin Against Paclitaxel-Induced Cardiotoxicity.
Journal: Food Sci Nutr | Authors: Tuğçe Tutar | Species: rat | Application: WB
Reviews
Write Your Own Review
Related Products
Check items to add to the cart or
