P54 of ASFV Polyclonal antibody 29511-1-AP proteintech
$149.00
In stock
SKU
29511-1-AP
| Catalog Number | 29511-1-AP |
| Synonyms | Ba71V-126, E183L, Inner membrane protein p54, pE183L |
| Host | Rabbit |
| Reactivity | asfv |
| Form | Liquid |
| Formulation | PBS, Azide, Glycerol |
| Applications | ELISA |
| Host / Isotype | Rabbit / IgG |
| Tested Applications — Positive ELISA detected in | FusionProtein |
| Positive ELISA detected in | FusionProtein |
| Enzyme-linked Immunosorbent Assay (ELISA) | ELISA : 1:556544-1:2226176 |
| Tested Reactivity | asfv |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen | CatNo: Ag31444 Product name: Recombinant asfv P54 of ASFV protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 1-65 aa of AAA65354 Sequence: VLIYLFSSRKKKAAAAIEEEDIQFINPYQDQQWAEVTPQPGTSKPAGATTASAGKPVTGRPATNR Predict reactive species |
| Full Name | Envelope protein p54 |
| Calculated Molecular Weight | 20 kDa |
| GenBank Accession Number | AAA65354 |
| Gene Symbol | P54 of ASFV |
| Gene ID (NCBI) | 22220355 |
| RRID | AB_2923593 |
| Conjugate | Unconjugated |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | Q65194 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA. |
| Citations | - |
| Dilutions | ELISA : 1:556544-1:2226176 |
| Isotype | IgG |
| Clonality | Polyclonal |
| Clone Number | - |
| Conjugation | Unconjugated |
Reviews
Write Your Own Review
Related Products
Check items to add to the cart or
