PACSIN2 Polyclonal antibody 10518-2-AP proteintech
$149.00
In stock
SKU
10518-2-AP
| Catalog Number | 10518-2-AP |
| Synonyms | Syndapin-II, Syndapin-2, SdpII, Protein kinase C and casein kinase substrate in neurons protein 2 |
| Host | Rabbit |
| Reactivity | human, mouse and More (2) |
| Reactivity | human, mouse, rat, zebrafish |
| Form | Liquid |
| Formulation | PBS, Azide, Glycerol |
| Applications | WB, IHC, IF/ICC, IP, ELISA |
| Host / Isotype | Rabbit / IgG |
| Tested Applications — Positive WB detected in | HEK-293 cells, mouse heart tissue, mouse lung tissue, NIH/3T3 cells, HepG2 cells |
| Tested Applications — Positive IP detected in | NIH/3T3 cells |
| Tested Applications — Positive IHC detected in | human breast cancer tissue, human skin tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
| Tested Applications — Positive IF/ICC detected in | NIH/3T3 cells |
| Recommended Dilutions — Western Blot (WB) | WB : 1:500-1:2000 |
| Recommended Dilutions — Immunoprecipitation (IP) | IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate |
| Recommended Dilutions — Immunohistochemistry (IHC) | IHC : 1:200-1:800 |
| Recommended Dilutions — Immunofluorescence (IF)/ICC | IF/ICC : 1:200-1:800 |
| Positive WB detected in | HEK-293 cells, mouse heart tissue, mouse lung tissue, NIH/3T3 cells, HepG2 cells |
| Positive IP detected in | NIH/3T3 cells |
| Positive IHC detected in | human breast cancer tissue, human skin tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
| Positive IF/ICC detected in | NIH/3T3 cells |
| Western Blot (WB) | WB : 1:500-1:2000 |
| Immunoprecipitation (IP) | IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate |
| Immunohistochemistry (IHC) | IHC : 1:200-1:800 |
| Immunofluorescence (IF)/ICC | IF/ICC : 1:200-1:800 |
| Tested Reactivity | human, mouse |
| Cited Reactivity | human, mouse, rat, zebrafish |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen | CatNo: Ag0809 Product name: Recombinant human PACSIN2 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 180-486 aa of BC008037 Sequence: PSLNPEQLKKLQDKIEKCKQDVLKTKEKYEKSLKELDQGTPQYMENMEQVFEQCQQFEEKRLRFFREVLLEVQKHLDLSNVAGYKAIYHDLEQSIRAADAVEDLRWFRANHGPGMAMNWPQFEEWSADLNRTLSRREKKKATDGVTLTGINQTGDQSLPSKPSSTLNVPSNPAQSAQSQSSYNPFEDEDDTGSTVSEKDDTKAKNVSSYEKTQSYPTDWSDDESNNPFSSTDANGDSNPFDDDATSGTEVRVRALYDYEGQEHDELSFKAGDELTKMEDEDEQGWCKGRLDNGQVGLYPANYVEAIQ Predict reactive species |
| Full Name | protein kinase C and casein kinase substrate in neurons 2 |
| Calculated Molecular Weight | 56 kDa |
| Observed Molecular Weight | 60-65 kDa |
| GenBank Accession Number | BC008037 |
| Gene Symbol | PACSIN2 |
| Gene ID (NCBI) | 11252 |
| RRID | AB_2161854 |
| Conjugate | Unconjugated |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | Q9UNF0 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA. |
| IF protocol for PACSIN2 antibody 10518-2-AP | Download protocol |
| IHC protocol for PACSIN2 antibody 10518-2-AP | Download protocol |
| IP protocol for PACSIN2 antibody 10518-2-AP | Download protocol |
| WB protocol for PACSIN2 antibody 10518-2-AP | Download protocol |
| human,mouse,zebrafish | WB,IF Nat Commun Investigation of F-BAR domain PACSIN proteins uncovers membrane tubulation function in cilia assembly and transport. Authors - Christine Insinna KO Validated View Article |
| mouse | WB,IF J Agric Food Chem Caveolin Regulates the Transport Mechanism of the Walnut-Derived Peptide EVSGPGYSPN to Penetrate the Blood-Brain Barrier Authors - Zehui Li View Article |
| rat | IF Acta Pharmacol Sin PACSIN2-mediated synaptic injury contributes to behavioral disorders caused by chronic stress. Authors - Chang-min Wang View Article |
| human | WB J Dent Res Proteome Analysis of Temporomandibular Joint with Disc Displacement Authors - X Liu View Article |
| Herve (Verified Customer) (11-13-2019) | This antibody recognizes a 55-kDa band that is present in both Pacsin2 WT and KO platelet lysates. PACSIN2 runs normally at 65 kDa in human and mouse platelet lysates and is absent in mouse Pacsin2 KO samples. Applications: Western Blot, Primary Antibody Dilution: 1/1000 Cell Tissue Type: Platelets |
| Citations | 10 |
| Dilutions | WB : 1:500-1:2000 IP : 0.5-4.0 ug for IP and 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate for WB IHC : 1:200-1:800 IF/ICC : 1:200-1:800 |
| Isotype | IgG |
| Clonality | Polyclonal |
| Clone Number | - |
| Conjugation | Unconjugated |
Peripheral membrane proteins of the Bin/amphiphysin/Rvs (BAR) and Fer-CIP4 homology-BAR (F-BAR) family participate in cellular membrane trafficking (PMID: 19549836). PACSIN2 (also known as syndapin-2) is a member of the protein kinase C and casein kinase substrate in neurons (PACSIN) family, which are membrane-binding proteins characterized by an amino-terminal F-BAR domain. PACSIN2 plays a role in intracellular vesicle-mediated transport. It is involved in the endocytosis of cell-surface receptors like the EGF receptor, contributing to its internalization (PMID: 23129763). PACSIN2 also has a role in caveolae membrane sculpting (PMID: 21610094). Protocols Product Specific Protocols IF protocol for PACSIN2 antibody 10518-2-AP Download protocol IHC protocol for PACSIN2 antibody 10518-2-AP Download protocol IP protocol for PACSIN2 antibody 10518-2-AP Download protocol WB protocol for PACSIN2 antibody 10518-2-AP Download protocol Standard Protocols Click here to view our Standard Protocols
Publications
- Investigation of F-BAR domain PACSIN proteins uncovers membrane tubulation function in cilia assembly and transport.
Journal: Nat Commun | Authors: Christine Insinna KO Validated | Species: human,mouse,zebrafish | Application: WB,IF - The molecular organization of differentially curved caveolae indicates bendable structural units at the plasma membrane
Journal: Nat Commun | Authors: Claudia Matthaeus | Species: mouse | Application: WB,IF - PACSIN2-mediated synaptic injury contributes to behavioral disorders caused by chronic stress.
Journal: Acta Pharmacol Sin | Authors: Chang-min Wang | Species: rat | Application: IF - Endogenous Cyclin D1 Promotes the Rate of Onset and Magnitude of Mitogenic Signaling via Akt1 Ser473 Phosphorylation.
Journal: Cell Rep | Authors: Ke Chen | Species: human | Application: WB - Caveolin Regulates the Transport Mechanism of the Walnut-Derived Peptide EVSGPGYSPN to Penetrate the Blood-Brain Barrier
Journal: J Agric Food Chem | Authors: Zehui Li | Species: mouse | Application: WB,IF - Proteome Analysis of Temporomandibular Joint with Disc Displacement
Journal: J Dent Res | Authors: X Liu | Species: human | Application: WB
Reviews
Write Your Own Review
Related Products
Check items to add to the cart or
