ACOT6 Polyclonal antibody 22936-1-AP proteintech
$149.00
In stock
SKU
22936-1-AP
| Catalog Number | 22936-1-AP |
| Synonyms | ACOT6, acyl CoA thioesterase 6, c14_5530, C14orf42 |
| Host | Rabbit |
| Reactivity | human, mouse, rat |
| Form | Liquid |
| Formulation | PBS, Azide, Glycerol |
| Applications | WB, IHC, ELISA |
| Host / Isotype | Rabbit / IgG |
| Tested Applications — Positive WB detected in | mouse liver tissue, HeLa cells |
| Tested Applications — Positive IHC detected in | human kidney tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
| Recommended Dilutions — Western Blot (WB) | WB : 1:500-1:2000 |
| Recommended Dilutions — Immunohistochemistry (IHC) | IHC : 1:20-1:200 |
| Positive WB detected in | mouse liver tissue, HeLa cells |
| Positive IHC detected in | human kidney tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
| Western Blot (WB) | WB : 1:500-1:2000 |
| Immunohistochemistry (IHC) | IHC : 1:20-1:200 |
| Tested Reactivity | human, mouse, rat |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen | CatNo: Ag18981 Product name: Recombinant human ACOT6 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 37-126 aa of BC126380 Sequence: TVLINACVANTVAPLHYKDMIIPKLVDDLGKVKITKSGFLTFMDTWSNPLEEHNHQSLVPLEKAQVPFLFIVGMDDQSWKSEFYAQIASE Predict reactive species |
| Full Name | acyl-CoA thioesterase 6 |
| Calculated Molecular Weight | 207 aa, 23 kDa |
| Observed Molecular Weight | 23 kDa |
| GenBank Accession Number | BC126380 |
| Gene Symbol | ACOT6 |
| Gene ID (NCBI) | 641372 |
| RRID | AB_11182380 |
| Conjugate | Unconjugated |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | Q3I5F7 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA. |
| IHC protocol for ACOT6 antibody 22936-1-AP | Download protocol |
| WB protocol for ACOT6 antibody 22936-1-AP | Download protocol |
| Citations | - |
| Dilutions | WB : 1:500-1:2000 IHC : 1:20-1:200 |
| Isotype | IgG |
| Clonality | Polyclonal |
| Clone Number | - |
| Conjugation | Unconjugated |
Reviews
Write Your Own Review
Related Products
Check items to add to the cart or
