Biotin-conjugated PD-L1/CD274 (C-terminal) Polyclonal antibody Biotin-28076 proteintech
$479.00
In stock
SKU
Biotin-28076
| Catalog Number | Biotin-28076 |
| Synonyms | B7 H, B7 H1, B7 homolog 1, B7H1, CD274, CD274 molecule, PD L1, PDCD1 ligand 1, PDCD1L1, PDCD1LG1, PDL1, Programmed death ligand 1 |
| Host | Rabbit |
| Reactivity | Human, mouse, rat |
| Reactivity | human, mouse, rat |
| Form | Liquid |
| Formulation | PBS, Proclin300, BSA, Glycerol |
| Applications | IHC |
| Host / Isotype | Rabbit / IgG |
| Tested Applications — Positive IHC detected in | human tonsillitis tissue, human placenta tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
| Recommended Dilutions — Immunohistochemistry (IHC) | IHC : 1:50-1:500 |
| Positive IHC detected in | human tonsillitis tissue, human placenta tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
| Immunohistochemistry (IHC) | IHC : 1:50-1:500 |
| Tested Reactivity | Human, mouse, rat |
| Cited Reactivity | mouse |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen | CatNo: Ag27557 Product name: Recombinant human PD-L1/CD274 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 181-290 aa of BC074984 Sequence: TTNSKREEKLFNVTSTLRINTTTNEIFYCTFRRLDPEENHTAELVIPELPLAHPPNERTHLVILGAILLCLGVALTFIFRLRKGRMMDVKKCGIQDTNSKKQSDTHLEET Predict reactive species |
| Full Name | CD274 molecule |
| Calculated Molecular Weight | 290 aa, 33 kDa |
| Observed Molecular Weight | 45-50 kDa |
| GenBank Accession Number | BC074984 |
| Gene Symbol | PD-L1 |
| Gene ID (NCBI) | 29126 |
| RRID | AB_2918943 |
| Conjugate | Biotin |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | Q9NZQ7 |
| Storage Buffer | PBS with 50% glycerol, 0.05% Proclin300, 0.5% BSA, pH 7.3. |
| Storage Conditions | Store at -20°C. Avoid exposure to light. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. |
| IHC protocol for Biotin PD-L1/CD274 (C-terminal) antibody Biotin-28076 | Download protocol |
| mouse | ACS Appl Mater Interfaces Harnessing Spatiotemporal-Specific Tumorous Exosome Dynamics: Ultra-Sensitive Lanthanide Luminescence Detection Strategy Enabled by Exosomal Membrane Engineering for Melanoma Immunotherapy Monitoring Authors - Nanhang Zhu View Article |
| Citations | 1 |
| Dilutions | IHC : 1:50-1:500 |
| Isotype | IgG |
| Clonality | Polyclonal |
| Clone Number | - |
| Conjugation | Biotin |
PD-L1, also known as CD274 or B7H1, stands for programmed cell death ligand 1. It is a type I transmembrane protein that is thought to repress immune responses by binding to its receptor (PD1), thus inhibiting T-cell activation, proliferation, and cytokine production. It contains V-like and C-like immunoglobulin domains. PD-L1 expression is regulated by various cytokines, such as TNF-α or LPS (ISSN: 1848-7718). Increased expression of this protein in certain types of cancers, e.g., renal cell carcinoma or colon cancer, correlates with poor prognosis. What is the molecular weight of PD-L1? Depending on the isoform, the calculated molecular weight of the protein varies between 20 and 33 kDa (176-290 aa). What are the isoforms of PD-L1? According to NCBI, three different isoforms have been identified. There are significant differences in the untranslated and protein coding regions. What is the subcellular localization and tissue specificity of PD-L1? It is predicted to localize in the plasma membrane of various cell types, with a particularly high expression in placental trophoblast and subsets of immune cells. High levels of PD-L1 protein have also been detected in lung and colon tissues. What is the function of PD-L1 in immune responses? PD-L1 is critical for the induction and maintenance of immune self-tolerance during infection or inflammation in normal tissues. The interaction of PD-L1 and its receptors is responsible for preventing auto-immune phenotypes and balancing the overall immune response in situations such as pregnancy or tissue allografts. The interaction between PD-L1 and PD-1 or B7.1 starts an inhibitory signaling cascade, which results in the decreased proliferation of antigen-specific T-cells and increased survival of regulatory T-cells (PMID: 15240681). How can PD-L1's implication in cancer be used as a drug target? In certain tumors, high expression of PD-L1 serves as a stop-sign to inhibit the recognition of cancer cells by T-cells (PMID: 23087408). The interaction between PD-L1 and its receptors (PD1 and B7.1) is a mechanism for the tumor to evade the host immune response (PMID: 29357948). Several mAbs have been developed to target that interaction and thus prevent the inactivation of cytotoxic T-cells by the tumor (PMIDs: 23890059, 18173375). Protocols Product Specific Protocols IHC protocol for Biotin PD-L1/CD274 (C-terminal) antibody Biotin-28076 Download protocol Standard Protocols Click here to view our Standard Protocols
Publications
- Harnessing Spatiotemporal-Specific Tumorous Exosome Dynamics: Ultra-Sensitive Lanthanide Luminescence Detection Strategy Enabled by Exosomal Membrane Engineering for Melanoma Immunotherapy Monitoring
Journal: ACS Appl Mater Interfaces | Authors: Nanhang Zhu | Species: mouse
Product Documents
Reviews
Write Your Own Review
Related Products
Check items to add to the cart or
