PDHX Polyclonal antibody 10951-1-AP proteintech
$149.00
In stock
SKU
10951-1-AP
| Catalog Number | 10951-1-AP |
| Synonyms | PDX1, pyruvate dehydrogenase complex, component X, Lipoyl-containing pyruvate dehydrogenase complex component X, E3-binding protein, E3 binding protein |
| Host | Rabbit |
| Reactivity | human, mouse, rat |
| Form | Liquid |
| Formulation | PBS, Azide, Glycerol |
| Applications | WB, IHC, IF, IP, CoIP, ELISA |
| Applications | WB, IHC, IP, ELISA |
| Host / Isotype | Rabbit / IgG |
| Tested Applications — Positive WB detected in | BxPC-3 cells, HEK-293 cells, SKOV-3 cells, HepG2 cells, NIH/3T3 cells, mouse kidney tissue |
| Tested Applications — Positive IP detected in | HEK-293 cells |
| Tested Applications — Positive IHC detected in | human colon cancer tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
| Recommended Dilutions — Western Blot (WB) | WB : 1:5000-1:50000 |
| Recommended Dilutions — Immunoprecipitation (IP) | IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate |
| Recommended Dilutions — Immunohistochemistry (IHC) | IHC : 1:20-1:200 |
| Positive WB detected in | BxPC-3 cells, HEK-293 cells, SKOV-3 cells, HepG2 cells, NIH/3T3 cells, mouse kidney tissue |
| Positive IP detected in | HEK-293 cells |
| Positive IHC detected in | human colon cancer tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
| Western Blot (WB) | WB : 1:5000-1:50000 |
| Immunoprecipitation (IP) | IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate |
| Immunohistochemistry (IHC) | IHC : 1:20-1:200 |
| Tested Reactivity | human, mouse, rat |
| Cited Reactivity | human, mouse, rat |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen | CatNo: Ag1389 Product name: Recombinant human PDHX protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-501 aa of BC010389 Sequence: MAASWRLGCDPRLLRYLVGFPGRRSVGLVKGALGWSVSRGANWRWFHSTQWLRGDPIKILMPSLSPTMEEGNIVKWLKKEGEAVSAGDALCEIETDKAVVTLDASDDGILAKIVVEEGSKNIRLGSLIGLIVEEGEDWKHVEIPKDVGPPPPVSKPSEPRPSPEPQISIPVKKEHIPGTLRFRLSPAARNILEKHSLDASQGTATGPRGIFTKEDALKLVQLKQTGKITESRPTPAPTATPTAPSPLQATAGPSYPRPVIPPVSTPGQPNAVGTFTEIPASNIRRVIAKRLTESKSTVPHAYATADCDLGAVLKVRQDLVKDDIKVSVNDFIIKAAAVTLKQMPDVNVSWDGEGPKQLPFIDISVAVATVKGLLTPIIKDAAAKGIQEIADSVKALSKKARDGKLLPEEYQGGSFSISNLGMFGIDEFTAVINPPQACILAVGRFRPVLKLTEDEEGNAKLQQRQLITVTMSSDSRVVDDELATRFLKSFKANLENPIRLA Predict reactive species |
| Full Name | pyruvate dehydrogenase complex, component X |
| Calculated Molecular Weight | 54 kDa |
| Observed Molecular Weight | 54 kDa |
| GenBank Accession Number | BC010389 |
| Gene Symbol | PDHX |
| Gene ID (NCBI) | 8050 |
| RRID | AB_2163102 |
| Conjugate | Unconjugated |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | O00330 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA. |
| IHC protocol for PDHX antibody 10951-1-AP | Download protocol |
| IP protocol for PDHX antibody 10951-1-AP | Download protocol |
| WB protocol for PDHX antibody 10951-1-AP | Download protocol |
| human | WB,IHC,IF Cancer Sci Identification of PDHX as a metabolic target for esophageal squamous cell carcinoma. Authors - Jun Inoue KD Validated View Article |
| mouse | WB Cell Calcium The Mitochondrial Ca 2+ import complex is altered in ADPKD Authors - Murali K Yanda View Article |
| rat | WB Int J Biol Sci Hypericin maintians PDX1 expression via the Erk pathway and protects islet β-cells against glucotoxicity and lipotoxicity. Authors - Chen Liang View Article |
| Citations | 19 |
| Dilutions | WB : 1:5000-1:50000 IP : 0.5-4.0 ug for IP and 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate for WB IHC : 1:20-1:200 |
| Isotype | IgG |
| Clonality | Polyclonal |
| Clone Number | - |
| Conjugation | Unconjugated |
PDHX (Pyruvate dehydrogenase protein X component), an E3-binding protein in the PDC, is acetylated by the p300 at Lys 488, impeding the interaction between PDHX and dihydrolipoyl transacetylase (E2), thereby disrupting PDC assembly to inhibit its activation (PMID: 30012170). PDHX was characterized as a metabolically essential gene for esophageal squamous cell carcinoma (ESCC), and knockdown of PDHX inhibited the proliferation of cancer stem cells (CSCs) and in vivo tumor growth (PMID: 33964039). Western blot analysis detected PDHX at an apparent molecular mass of 54 kDa. Protocols Product Specific Protocols IHC protocol for PDHX antibody 10951-1-AP Download protocol IP protocol for PDHX antibody 10951-1-AP Download protocol WB protocol for PDHX antibody 10951-1-AP Download protocol Standard Protocols Click here to view our Standard Protocols
Publications
- Intestinal metabolite TMAO promotes CKD progression by stimulating macrophage M2 polarization through histone H4 lysine 12 lactylation
Journal: Cell Death Differ | Authors: Youzhou Tang - Low-dose deoxynivalenol exposure inhibits hepatic mitophagy and hesperidin reverses this phenomenon by activating SIRT1
Journal: J Hazard Mater | Authors: Hao Chen | Application: IF - Identification of PDHX as a metabolic target for esophageal squamous cell carcinoma.
Journal: Cancer Sci | Authors: Jun Inoue KD Validated | Species: human | Application: WB,IHC,IF - The Mitochondrial Ca 2+ import complex is altered in ADPKD
Journal: Cell Calcium | Authors: Murali K Yanda | Species: mouse | Application: WB - Singapore Grouper Iridovirus Induces Glucose Metabolism in Infected Cells by Activation of Mammalian Target of Rapamycin Signaling.
Journal: Front Microbiol | Authors: Xixi Guo KD Validated | Application: WB - Hypericin maintians PDX1 expression via the Erk pathway and protects islet β-cells against glucotoxicity and lipotoxicity.
Journal: Int J Biol Sci | Authors: Chen Liang | Species: rat | Application: WB
Reviews
Write Your Own Review
Related Products
Check items to add to the cart or
