PDPK1 Polyclonal antibody 17086-1-AP proteintech
$149.00
In stock
SKU
17086-1-AP
| Catalog Number | 17086-1-AP |
| Synonyms | hPDK1, PDK1, PDPK1, PRO0461 |
| Host | Rabbit |
| Reactivity | human and More (1) |
| Reactivity | human, mouse |
| Form | Liquid |
| Formulation | PBS, Azide, Glycerol |
| Applications | WB, IHC, IF, ELISA |
| Applications | WB, IHC, ELISA |
| Host / Isotype | Rabbit / IgG |
| Tested Applications — Positive WB detected in | MCF-7 cells, LNCaP cells |
| Tested Applications — Positive IHC detected in | human breast cancer tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
| Recommended Dilutions — Western Blot (WB) | WB : 1:500-1:2000 |
| Recommended Dilutions — Immunohistochemistry (IHC) | IHC : 1:50-1:500 |
| Positive WB detected in | MCF-7 cells, LNCaP cells |
| Positive IHC detected in | human breast cancer tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
| Western Blot (WB) | WB : 1:500-1:2000 |
| Immunohistochemistry (IHC) | IHC : 1:50-1:500 |
| Tested Reactivity | human |
| Cited Reactivity | human, mouse |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen | CatNo: Ag9213 Product name: Recombinant human PDPK1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 198-556 aa of BC012103 Sequence: GKGIIHRDLKPENILLNEDMHIQITDFGTAKVLSPESKQARANSFVGTAQYVSPELLTEKSACKSSDLWALGCIIYQLVAGLPPFRAGNEYLIFQKIIKLEYDFPEKFFPKARDLVEKLLVLDATKRLGCEEMEGYGPLKAHPFFESVTWENLHQQTPPKLTAYLPAMSEDDEDCYGNYDNLLSQFGCMQVSSSSSSHSLSASDTGLPQRSGSNIEQYIHDLDSNSFELDLQFSEDEKRLLLEKQAGGNPWHQFVENNLILKMGPVDKRKGLFARRRQLLLTEGPHLYYVDPVNKVLKGEIPWSQELRPEAKNFKTFFVHTPNRTYYLMDPSGNAHKWCRKIQEVWRQRYQSHPDAAVQ Predict reactive species |
| Full Name | 3-phosphoinositide dependent protein kinase-1 |
| Calculated Molecular Weight | 556 aa, 63 kDa |
| Observed Molecular Weight | 60-63 kDa |
| GenBank Accession Number | BC012103 |
| Gene Symbol | PDPK1 |
| Gene ID (NCBI) | 5170 |
| RRID | AB_2161289 |
| Conjugate | Unconjugated |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | O15530 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA. |
| IHC protocol for PDPK1 antibody 17086-1-AP | Download protocol |
| WB protocol for PDPK1 antibody 17086-1-AP | Download protocol |
| mouse | WB J Innate Immun Mannan-Binding Lectin Reduces Epithelial-Mesenchymal Transition in Pulmonary Fibrosis via Inactivating the Store-Operated Calcium Entry Machinery. Authors - Yunzhi Liu View Article |
| human | IHC Front Immunol Identification of senescence-related subtypes, establishment of a prognosis model, and characterization of a tumor microenvironment infiltration in breast cancer Authors - Yanling Zhou KD Validated View Article |
| Citations | 19 |
| Dilutions | WB : 1:500-1:2000 IHC : 1:50-1:500 |
| Isotype | IgG |
| Clonality | Polyclonal |
| Clone Number | - |
| Conjugation | Unconjugated |
3-Phosphoinositide dependent protein kinase-1 (PDK1 or PDPK1) is a serine-threonine kinase belonging to AGC kinase family. PDK1 plays a critical role in establishing ACD (Asymmetric cell division) in the epithelium (PMID: 27184845). The kinase activity of PDK1 depends on phosphatidyl inositol 3-kinase (PI3K), a key intermediate in signaling pathways including those from growth factor receptors and adhesion molecules. Substrates of PDK1, including AKT and the protein kinase C (PKC) isozymes, regulate a number of essential cell functions (PMID: 20027184). PDPK1 has 5 isoforms produced by alternative splicing of 48~63 kDa and is detected as 60-63 kDa. Protocols Product Specific Protocols IHC protocol for PDPK1 antibody 17086-1-AP Download protocol WB protocol for PDPK1 antibody 17086-1-AP Download protocol Standard Protocols Click here to view our Standard Protocols
Publications
- A Non-canonical PDK1-RSK Signal Diminishes Pro-caspase-8-Mediated Necroptosis Blockade.
Journal: Mol Cell | Authors: Zhang-Hua Yang KO Validated | Species: mouse | Application: WB - Phosphocholine inhibits proliferation and reduces stemness of endometrial cancer cells by downregulating mTOR-c-Myc signaling
Journal: Cell Mol Life Sci | Authors: Kunxiang Gong | Species: human | Application: WB - Loss of hepatic aldolase B activates Akt and promotes hepatocellular carcinogenesis by destabilizing the Aldob/Akt/PP2A protein complex.
Journal: PLoS Biol | Authors: Xuxiao He | Species: human | Application: WB - Redox sensor NPGPx restrains ZAP70 activity and modulates T cell homeostasis.
Journal: Free Radic Biol Med | Authors: Fang-Yi Su | Species: human | Application: WB - Identification of senescence-related subtypes, establishment of a prognosis model, and characterization of a tumor microenvironment infiltration in breast cancer
Journal: Front Immunol | Authors: Yanling Zhou KD Validated | Species: human | Application: IHC - Mannan-Binding Lectin Reduces Epithelial-Mesenchymal Transition in Pulmonary Fibrosis via Inactivating the Store-Operated Calcium Entry Machinery.
Journal: J Innate Immun | Authors: Yunzhi Liu | Species: mouse | Application: WB - Identification of senescence-related subtypes, establishment of a prognosis model, and characterization of a tumor microenvironment infiltration in breast cancer
Journal: Front Immunol | Authors: Yanling Zhou | Species: human | Application: IHC - Loss of hepatic aldolase B activates Akt and promotes hepatocellular carcinogenesis by destabilizing the Aldob/Akt/PP2A protein complex.
Journal: PLoS Biol | Authors: Xuxiao He | Species: human | Application: WB - SENP3 promotes PDPK1 deSUMOylation to inhibit the PI3K-Akt signaling pathway and induce apoptosis in intestinal ischemia/reperfusion.
Journal: Biochem Pharmacol | Authors: Renwu Liu - Phosphocholine inhibits proliferation and reduces stemness of endometrial cancer cells by downregulating mTOR-c-Myc signaling
Journal: Cell Mol Life Sci | Authors: Kunxiang Gong | Species: human | Application: WB - WDR54 exerts oncogenic roles in T-cell acute lymphoblastic leukemia
Journal: Cancer Sci | Authors: Huan Li | Species: human | Application: WB - Transfection with GLS2 Glutaminase (GAB) Sensitizes Human Glioblastoma Cell Lines to Oxidative Stress by a Common Mechanism Involving Suppression of the PI3K/AKT Pathway.
Journal: Cancers (Basel) | Authors: Ewelina Majewska | Species: human | Application: WB - PDPK1 governs macrophage M2 polarization via hypoxia-driven CD47/AKT-glycolytic Axis in endometriosis
Journal: Cell Signal | Authors: Han Li | Species: human | Application: WB,IHC - Mannan-Binding Lectin Reduces Epithelial-Mesenchymal Transition in Pulmonary Fibrosis via Inactivating the Store-Operated Calcium Entry Machinery.
Journal: J Innate Immun | Authors: Yunzhi Liu | Species: mouse | Application: WB - Activation of long-non-coding RNA NEAT1 sponging microRNA-147 inhibits radiation damage by targeting PDPK1 in troxerutin radioprotection
Journal: iScience | Authors: Yong-Jian Hu | Species: human,mouse | Application: WB,IF - HIF-1α Mediates Arsenic-Induced Metabolic Reprogramming in Lung Bronchial Epithelial Cells.
Journal: Biol Trace Elem Res | Authors: Wenjuan Wang | Species: human | Application: WB - In Vitro and Vivo Experiments Revealing Astragalin Inhibited Lung Adenocarcinoma Development via LINC00582/miR-140-3P/PDPK1
Journal: J Biochem Mol Toxicol | Authors: Juncheng Bai | Species: human | Application: WB - IGF2BP2 regulates gastric cancer radiotherapy resistance through HIF1α-mediated glycolysis
Journal: Front Oncol | Authors: Qi Zhang - LncRNA CAR10 Upregulates PDPK1 to Promote Cervical Cancer Development by Sponging miR-125b-5p.
Journal: Biomed Res Int | Authors: Tingting Hu | Species: human | Application: WB
Reviews
Write Your Own Review
Related Products
Check items to add to the cart or
