PDXP Polyclonal antibody 27490-1-AP proteintech
$149.00
In stock
SKU
27490-1-AP
| Catalog Number | 27490-1-AP |
| Synonyms | CIN, PDXP, PLP, PLP phosphatase, PLPP |
| Host | Rabbit |
| Reactivity | Human, mouse and More (1) |
| Reactivity | human, mouse |
| Form | Liquid |
| Formulation | PBS, Azide, Glycerol |
| Applications | WB, IHC, ELISA |
| Host / Isotype | Rabbit / IgG |
| Tested Applications — Positive WB detected in | HeLa cells, Neuro-2a cells, mouse brain tissue |
| Tested Applications — Positive IHC detected in | human liver tissue, human tonsillitis tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
| Recommended Dilutions — Western Blot (WB) | WB : 1:500-1:1000 |
| Recommended Dilutions — Immunohistochemistry (IHC) | IHC : 1:50-1:500 |
| Positive WB detected in | HeLa cells, Neuro-2a cells, mouse brain tissue |
| Positive IHC detected in | human liver tissue, human tonsillitis tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
| Western Blot (WB) | WB : 1:500-1:1000 |
| Immunohistochemistry (IHC) | IHC : 1:50-1:500 |
| Tested Reactivity | Human, mouse |
| Cited Reactivity | human, mouse |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen | CatNo: Ag26592 Product name: Recombinant human PDXP protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 115-230 aa of BC064922 Sequence: GEGLRAELRAAGLRLAGDPSAGDGAAPRVRAVLVGYDEHFSFAKLREACAHLRDPECLLVATDRDPWHPLSDGSRTPGTGSLAAAVETASGRQALVVGKPSPYMFECITENFSIDP Predict reactive species |
| Full Name | pyridoxal (pyridoxine, vitamin B6) phosphatase |
| Calculated Molecular Weight | 32 kDa |
| Observed Molecular Weight | 32 kDa |
| GenBank Accession Number | BC064922 |
| Gene Symbol | PDXP |
| Gene ID (NCBI) | 57026 |
| RRID | AB_2880887 |
| Conjugate | Unconjugated |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | Q96GD0 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA. |
| IHC protocol for PDXP antibody 27490-1-AP | Download protocol |
| WB protocol for PDXP antibody 27490-1-AP | Download protocol |
| human,mouse | WB,IHC Mol Carcinog p110CUX1 promotes acute myeloid leukemia progression via regulating pyridoxal phosphatase expression and activating PI3K/AKT/mTOR signaling pathway Authors - Hongyan Zhang KD Validated View Article |
| mouse | WB Dev Cell Vitamin B6 preserves the stemness-like phenotypes and antitumor ability of CD8(+) T cells. Authors - Jun Wu View Article |
| Citations | 2 |
| Dilutions | WB : 1:500-1:1000 IHC : 1:50-1:500 |
| Isotype | IgG |
| Clonality | Polyclonal |
| Clone Number | - |
| Conjugation | Unconjugated |
PDXP, also named CIN, belongs to the HAD-like hydrolase superfamily. As a pyridoxal phosphate (PLP) phosphatase, PDXP can catalyzes the dephosphorylation of pyridoxine 5'-phosphate (PNP) and pyridoxamine 5'-phosphate (PMP), with order of substrate preference PLP > PNP > PMP and therefore plays a role in vitamin B6 metabolism. PDXP is highly expressed in all the regions of central nerve system except the spinal cord. PDXP is also expressed at high level in liver and testis. Protocols Product Specific Protocols IHC protocol for PDXP antibody 27490-1-AP Download protocol WB protocol for PDXP antibody 27490-1-AP Download protocol Standard Protocols Click here to view our Standard Protocols
Publications
- p110CUX1 promotes acute myeloid leukemia progression via regulating pyridoxal phosphatase expression and activating PI3K/AKT/mTOR signaling pathway
Journal: Mol Carcinog | Authors: Hongyan Zhang KD Validated | Species: human,mouse | Application: WB,IHC - Vitamin B6 preserves the stemness-like phenotypes and antitumor ability of CD8(+) T cells.
Journal: Dev Cell | Authors: Jun Wu | Species: mouse | Application: WB
Reviews
Write Your Own Review
Related Products
Check items to add to the cart or
