MAP17 / PDZK1IP1 Polyclonal antibody 12518-1-AP proteintech
$149.00
In stock
SKU
12518-1-AP
| Catalog Number | 12518-1-AP |
| Synonyms | Protein DD96, PDZK1IP1, PDZK1-interacting protein 1, MAP17, 17 kDa membrane-associated protein |
| Host | Rabbit |
| Reactivity | human |
| Form | Liquid |
| Formulation | PBS, Azide, Glycerol |
| Applications | WB, IHC, IF/ICC, ELISA |
| Applications | IHC, IF/ICC, ELISA |
| Host / Isotype | Rabbit / IgG |
| Tested Applications — Positive IHC detected in | human kidney tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
| Tested Applications — Positive IF/ICC detected in | PC-3 cells |
| Recommended Dilutions — Immunohistochemistry (IHC) | IHC : 1:50-1:500 |
| Recommended Dilutions — Immunofluorescence (IF)/ICC | IF/ICC : 1:200-1:800 |
| Positive IHC detected in | human kidney tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
| Positive IF/ICC detected in | PC-3 cells |
| Immunohistochemistry (IHC) | IHC : 1:50-1:500 |
| Immunofluorescence (IF)/ICC | IF/ICC : 1:200-1:800 |
| Tested Reactivity | human |
| Cited Reactivity | human |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen | CatNo: Ag3206 Product name: Recombinant human PDZK1IP1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 15-114 aa of BC012303 Sequence: VPPASCQQGLGNLQPWMQGLIAVAVFLVLVAIAFAVKHFWCQEEPEPAHMILTVGNKADGVLVGTDGRYSSMAASFRSSEHENAYENVPEEEGKVRSTPM Predict reactive species |
| Full Name | PDZK1 interacting protein 1 |
| Calculated Molecular Weight | 114 aa, 12 kDa |
| GenBank Accession Number | BC012303 |
| Gene Symbol | MAP17 |
| Gene ID (NCBI) | 10158 |
| RRID | AB_3085395 |
| Conjugate | Unconjugated |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | Q13113 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA. |
| IF protocol for MAP17 / PDZK1IP1 antibody 12518-1-AP | Download protocol |
| IHC protocol for MAP17 / PDZK1IP1 antibody 12518-1-AP | Download protocol |
| human | WB Cytojournal Mechanistic insights into PDZK1-interacting protein 1 on the malignant progression of colorectal carcinoma Authors - Kuaiyun Yu View Article |
| Citations | 1 |
| Dilutions | IHC : 1:50-1:500 IF/ICC : 1:200-1:800 |
| Isotype | IgG |
| Clonality | Polyclonal |
| Clone Number | - |
| Conjugation | Unconjugated |
PDZK1-interacting protein 1(PDZK1IP1), also known as MAP17, is a membrane-associated protein. MAP17 / PDZK1IP1 is overexpressed in a variety of human carcinomas, and overexpression of MAP17 / PDZK1IP1 protein is strongly correlated with the progression of prostate and ovarian carcinomas (PMID: 17426052). MAP17 / PDZK1IP1 has been proven to be an oncogene for tumorigenesis and development of papillary thyroid cancer (PTC) (PMID: 36057192; PMID: 35727731). Protocols Product Specific Protocols IF protocol for MAP17 / PDZK1IP1 antibody 12518-1-AP Download protocol IHC protocol for MAP17 / PDZK1IP1 antibody 12518-1-AP Download protocol Standard Protocols Click here to view our Standard Protocols
Publications
- Mechanistic insights into PDZK1-interacting protein 1 on the malignant progression of colorectal carcinoma
Journal: Cytojournal | Authors: Kuaiyun Yu | Species: human | Application: WB
Reviews
Write Your Own Review
Related Products
Check items to add to the cart or
