PFKFB2 Recombinant monoclonal antibody, PBS Only (Detector) 85639-5-PBS proteintech
$699.00
In stock
SKU
85639-5-PBS
| Catalog Number | 85639-5-PBS |
| Synonyms | 6PF-2-K/Fru-2,6-P2ase 2, 6PF-2-K/Fru-2,6-P2ase heart-type isozyme, 6-phosphofructo-2-kinase, 6-phosphofructo-2-kinase/fructose-2,6-bisphosphatase 2, Fructose-2,6-bisphosphatase |
| Host | Rabbit |
| Reactivity | human |
| Form | Liquid |
| Formulation | PBS Only |
| Applications | Sandwich ELISA, Indirect ELISA |
| Host / Isotype | Rabbit / IgG |
| Tested Reactivity | human |
| Class | Recombinant |
| Type | Antibody |
| Immunogen | CatNo: Ag32347 Product name: Recombinant human PFKFB2 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 430-505 aa of BC075076 Sequence: CKVETIKLNVEAVNTHRDKPTNNFPKNQTPVRMRRNSFTPLSSSNTIRRPRNYSVGSRPLKPLSPLRAQDMQEGAD Predict reactive species |
| Full Name | 6-phosphofructo-2-kinase/fructose-2,6-biphosphatase 2 |
| Calculated Molecular Weight | 505 aa, 58 kDa |
| GenBank Accession Number | BC075076 |
| Gene Symbol | PFKFB2 |
| Gene ID (NCBI) | 5208 |
| Conjugate | Unconjugated |
| Purification Method | Protein A purification |
| UNIPROT ID | O60825 |
| Storage Buffer | PBS only, pH 7.3. |
| Storage Conditions | Store at -80°C. |
| Citations | - |
| Isotype | IgG |
| Clonality | Recombinant |
| Clone Number | 243136A8 |
| Conjugation | Unconjugated |
Reviews
Write Your Own Review
Related Products
Check items to add to the cart or
