CoraLite® Plus 488-conjugated PFKM Recombinant monoclonal antibody CL488-84281-5 proteintech
$479.00
In stock
SKU
CL488-84281-5
| Catalog Number | CL488-84281-5 |
| Synonyms | 241598B2, 6-phosphofructokinase type A, ATP-dependent 6-phosphofructokinase, muscle type, ATP-PFK, EC:2.7.1.11 |
| Host | Rabbit |
| Reactivity | human, mouse |
| Form | Liquid |
| Formulation | PBS, Proclin300, BSA, Glycerol |
| Applications | IF/ICC |
| Host / Isotype | Rabbit / IgG |
| Tested Applications — Positive IF/ICC detected in | HeLa cells |
| Recommended Dilutions — Immunofluorescence (IF)/ICC | IF/ICC : 1:50-1:500 |
| Positive IF/ICC detected in | HeLa cells |
| Immunofluorescence (IF)/ICC | IF/ICC : 1:50-1:500 |
| Tested Reactivity | human, mouse |
| Class | Recombinant |
| Type | Antibody |
| Immunogen | CatNo: Ag30840 Product name: Recombinant human PFKM protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 675-725 aa of BC021203 Sequence: FATKMGAKAMNWMSGKIKESYRNGRIFANTPDSGCVLGMRKRALVFQPVAE Predict reactive species |
| Full Name | phosphofructokinase, muscle |
| Observed Molecular Weight | 75-85 kDa |
| GenBank Accession Number | BC021203 |
| Gene Symbol | PFKM |
| Gene ID (NCBI) | 5213 |
| RRID | AB_3747521 |
| Conjugate | CoraLite® Plus 488 Fluorescent Dye |
| Excitation/Emission Maxima Wavelengths | 493 nm / 522 nm |
| Excitation Laser | Blue laser (488 nm) |
| Purification Method | Protein A purification |
| UNIPROT ID | P08237 |
| Storage Buffer | PBS with 50% glycerol, 0.05% Proclin300, 0.5% BSA, pH 7.3. |
| Storage Conditions | Store at -20°C. Avoid exposure to light. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. |
| IF protocol for CL Plus 488 PFKM antibody CL488-84281-5 | Download protocol |
| Citations | - |
| Dilutions | IF/ICC : 1:50-1:500 |
| Isotype | IgG |
| Clonality | Recombinant |
| Clone Number | 241598B2 |
| Conjugation | CoraLite® Plus 488 |
PFKM, also named as GSD7, PFK-1, PFK-M and PFKX, belongs to the phosphofructokinase family and two domains subfamily. PFKM catalyzes the reaction: ATP + D-fructose 6-phosphate = ADP + D-fructose 1,6-bisphosphate. It is a key regulatory enzyme in glycolysis. Defects in PFKM cause glycogen storage disease type 7 (GSD7). PFKM has three isoforms with molecular weights of 85, 82, and 93 kDa. Protocols Product Specific Protocols IF protocol for CL Plus 488 PFKM antibody CL488-84281-5 Download protocol Standard Protocols Click here to view our Standard Protocols
Product Documents