PHPT1 Recombinant monoclonal antibody, PBS Only 86736-3-PBS proteintech
$699.00
In stock
SKU
86736-3-PBS
| Catalog Number | 86736-3-PBS |
| Synonyms | CGI-202, EC:3.9.1.3, HSPC141, PHP, PHP14 |
| Host | Rabbit |
| Reactivity | human |
| Form | Liquid |
| Formulation | PBS Only |
| Applications | WB, IF/ICC, Indirect ELISA |
| Host / Isotype | Rabbit / IgG |
| Tested Reactivity | human |
| Class | Recombinant |
| Type | Antibody |
| Immunogen | CatNo: Ag3778 Product name: Recombinant human PHPT1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-125 aa of BC024648 Sequence: MAVADLALIPDVDIDSDGVFKYVLIRVHSAPRSGAPAAESKEIVRGYKWAEYHADIYDKVSGDMQKQGCDCECLGGGRISHQSQDKKIHVYGYSMAYGPAQHAISTEKIKAKYPDYEVTWANDGY Predict reactive species |
| Full Name | phosphohistidine phosphatase 1 |
| Calculated Molecular Weight | 125 aa, 14 kDa |
| Observed Molecular Weight | 14 kDa |
| GenBank Accession Number | BC024648 |
| Gene Symbol | PHPT1 |
| Gene ID (NCBI) | 29085 |
| RRID | AB_3745092 |
| Conjugate | Unconjugated |
| Purification Method | Protein A purification |
| UNIPROT ID | Q9NRX4 |
| Storage Buffer | PBS only, pH 7.3. |
| Storage Conditions | Store at -80°C. |
| Citations | - |
| Isotype | IgG |
| Clonality | Recombinant |
| Clone Number | 251432C1 |
| Conjugation | Unconjugated |
Reviews
Write Your Own Review
Related Products
Check items to add to the cart or
