PIGP Polyclonal antibody 30623-1-AP proteintech
$149.00
In stock
SKU
30623-1-AP
| Catalog Number | 30623-1-AP |
| Synonyms | DCRC, DSCR5, DSCRC, DSRC, NPD010 |
| Host | Rabbit |
| Reactivity | human, mouse |
| Form | Liquid |
| Formulation | PBS, Azide, Glycerol |
| Applications | IHC, IP, ELISA |
| Host / Isotype | Rabbit / IgG |
| Tested Applications — Positive IP detected in | U-87 MG cells |
| Tested Applications — Positive IHC detected in | human renal cell carcinoma tissue, mouse stomach tissue, human placenta tissue, mouse kidney tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
| Recommended Dilutions — Immunoprecipitation (IP) | IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate |
| Recommended Dilutions — Immunohistochemistry (IHC) | IHC : 1:1000-1:4000 |
| Positive IP detected in | U-87 MG cells |
| Positive IHC detected in | human renal cell carcinoma tissue, mouse stomach tissue, human placenta tissue, mouse kidney tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
| Immunoprecipitation (IP) | IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate |
| Immunohistochemistry (IHC) | IHC : 1:1000-1:4000 |
| Tested Reactivity | human, mouse |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen | CatNo: Ag29498 Product name: Recombinant human PIGP protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 70-134 aa of BC005180 Sequence: YVLLFGINMMSTSPLDSIHTITDNYAKNQQQKKYQEEAIPALRDISISEVNQMFFLAAKELYTKN Predict reactive species |
| Full Name | phosphatidylinositol glycan anchor biosynthesis, class P |
| Calculated Molecular Weight | 18 kDa |
| Observed Molecular Weight | 15~18 kDa |
| GenBank Accession Number | BC005180 |
| Gene Symbol | PIGP |
| Gene ID (NCBI) | 51227 |
| RRID | AB_3669740 |
| Conjugate | Unconjugated |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | P57054 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA. |
| IHC protocol for PIGP antibody 30623-1-AP | Download protocol |
| IP protocol for PIGP antibody 30623-1-AP | Download protocol |
| Citations | - |
| Dilutions | IP : 0.5-4.0 ug for IP and 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate for WB IHC : 1:1000-1:4000 |
| Isotype | IgG |
| Clonality | Polyclonal |
| Clone Number | - |
| Conjugation | Unconjugated |
Phosphatidylinositol glycan anchor biosynthesis, class P (PIGP), a member of the large glycosylphosphatidylinositol (GPI) anchor biosynthesis gene family, encodes a subunit of the enzyme that catalyzes the first step of GPI anchor biosynthesis (PMID: 28334793). Mutations in the PIGP gene can lead to a variety of disorders, including developmental delay, intellectual disability, seizures, dysmorphic features, and diverse congenital anomalies. Protocols Product Specific Protocols IHC protocol for PIGP antibody 30623-1-AP Download protocol IP protocol for PIGP antibody 30623-1-AP Download protocol Standard Protocols Click here to view our Standard Protocols
Reviews
Write Your Own Review
Related Products
Check items to add to the cart or
