PIP Recombinant monoclonal antibody, PBS Only (Detector) 86152-3-PBS proteintech
$699.00
In stock
SKU
86152-3-PBS
| Catalog Number | 86152-3-PBS |
| Synonyms | GCDFP15, GCDFP-15, gp17, GPIP4, prolactin induced protein |
| Host | Rabbit |
| Reactivity | human |
| Form | Liquid |
| Formulation | PBS Only |
| Applications | Sandwich ELISA, Indirect ELISA |
| Host / Isotype | Rabbit / IgG |
| Tested Reactivity | human |
| Class | Recombinant |
| Type | Antibody |
| Immunogen | CatNo: Eg3018 Product name: Recombinant Human PIP protein (rFc Tag) Source: mammalian cells -derived, V37 Tag: C-rFc Domain: 29-146 aa of NM_002652.3 Sequence: QDNTRKIIIKNFDIPKSVRPNDEVTAVLAVQTELKECMVVKTYLISSIPLQGAFNYKYTACLCDDNPKTFYWDFYTNRTVQIAAVVDVIRELGICPDDAAVIPIKNNRFYTIEILKVE Predict reactive species |
| Full Name | prolactin-induced protein |
| Calculated Molecular Weight | 17 kDa |
| GenBank Accession Number | NM_002652.3 |
| Gene Symbol | GCDFP-15 |
| Gene ID (NCBI) | 5304 |
| Conjugate | Unconjugated |
| Purification Method | Protein A purification |
| UNIPROT ID | P12273 |
| Storage Buffer | PBS only, pH 7.3. |
| Storage Conditions | Store at -80°C. |
| Citations | - |
| Isotype | IgG |
| Clonality | Recombinant |
| Clone Number | 250676B11 |
| Conjugation | Unconjugated |
Reviews
Write Your Own Review
Related Products
Check items to add to the cart or
