PKLR Recombinant monoclonal antibody, PBS Only (Detector) 86485-1-PBS proteintech
$699.00
In stock
SKU
86485-1-PBS
| Catalog Number | 86485-1-PBS |
| Synonyms | EC:2.7.1.40, PK1, PKL, Pyruvate kinase isozymes L/R, Pyruvate kinase PKLR |
| Host | Rabbit |
| Reactivity | human |
| Form | Liquid |
| Formulation | PBS Only |
| Applications | WB, Sandwich ELISA, Indirect ELISA |
| Host / Isotype | Rabbit / IgG |
| Tested Reactivity | human |
| Class | Recombinant |
| Type | Antibody |
| Immunogen | CatNo: Ag17933 Product name: Recombinant human PKLR protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 446-556 aa of BC025737 Sequence: PLSRDPTEVTAIGAVEAAFKCCAAAIIVLTTTGRSAQLLSRYRPRAAVIAVTRSAQAARQVHLCRGVFPLLYREPPEAIWADDVDRRVQFGIESGKLRGFLRVGDLVIVVT Predict reactive species |
| Full Name | pyruvate kinase, liver and RBC |
| Calculated Molecular Weight | 574 aa, 62 kDa |
| Observed Molecular Weight | 58-62 kDa |
| GenBank Accession Number | BC025737 |
| Gene Symbol | PKLR |
| Gene ID (NCBI) | 5313 |
| RRID | AB_3744917 |
| Conjugate | Unconjugated |
| Purification Method | Protein A purification |
| UNIPROT ID | P30613 |
| Storage Buffer | PBS only, pH 7.3. |
| Storage Conditions | Store at -80°C. |
| Citations | - |
| Isotype | IgG |
| Clonality | Recombinant |
| Clone Number | 251231F12 |
| Conjugation | Unconjugated |
PKLR(Pyruvate kinase isozymes R/L) is also named as PK1,PKL,which is a glycolytic enzyme that catalyzes the transphosphorylation from phosphoenolpyruvate (PEP) to ADP, yielding pyruvate and ATP. It is the last step of the glycolytic pathway and is essentially irreversible.It belongs to the pyruvate kinase family and There are 4 isozymes of pyruvate kinase in mammals: L, R, M1 and M2. L type is major isozyme in the liver, R is found in red cells, M1 is the main form in muscle, heart and brain, and M2 is found in early fetal tissues.Defects in PKLR are the cause of pyruvate kinase hyperactivity (PKHYP) and pyruvate kinase deficiency of red cells (PKRD).It can form a homotetramer(PMID:11960989).
Reviews
Write Your Own Review
Related Products
Check items to add to the cart or
