PLA2G1B Monoclonal antibody, PBS Only (Capture) 66397-1-PBS proteintech
$699.00
In stock
SKU
66397-1-PBS
| Catalog Number | 66397-1-PBS |
| Synonyms | 1F2C10, EC:3.1.1.4, Phosphatidylcholine 2-acylhydrolase 1B, PLA2 |
| Host | Mouse |
| Reactivity | human, pig |
| Form | Liquid |
| Formulation | PBS Only |
| Applications | WB, IHC, Cytometric bead array, Indirect ELISA, Sample test |
| Host / Isotype | Mouse / IgG2a |
| Tested Reactivity | human, pig |
| Class | Monoclonal |
| Type | Antibody |
| Immunogen | CatNo: Ag8812 Product name: Recombinant human PLA2G1B protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 1-70 aa of BC005386 Sequence: MKLLVLAVLLTVAAADSGISPRAVWQFRKMIKCVIPGSDPFLEYNNYGCYCGLGGSGTPVDELDKQKQRV Predict reactive species |
| Full Name | phospholipase A2, group IB (pancreas) |
| Calculated Molecular Weight | 70aa,8 kDa; 148aa,16 kDa |
| Observed Molecular Weight | 13-16 kDa |
| GenBank Accession Number | BC005386 |
| Gene Symbol | PLA2G1B |
| Gene ID (NCBI) | 5319 |
| RRID | AB_2881771 |
| Conjugate | Unconjugated |
| Purification Method | Protein A purification |
| UNIPROT ID | P04054 |
| Storage Buffer | PBS only, pH 7.3. |
| Storage Conditions | Store at -80°C. |
| Citations | - |
| Isotype | IgG2a |
| Clonality | Monoclonal |
| Clone Number | 1F2C10 |
| Conjugation | Unconjugated |
PLA2G1B is a secreted member of the phospholipase A2 (PLA2) class of enzymes, which is produced by the pancreatic acinar cells. PLA2G1B catalyzes the hydrolysis of the sn-2 position of membrane glycerophospholipids to release arachidonic acid (AA) and lysophospholipids.
Reviews
Write Your Own Review
Related Products
Check items to add to the cart or
