PLAC9 Polyclonal antibody 17910-1-AP proteintech
$149.00
In stock
SKU
17910-1-AP
| Catalog Number | 17910-1-AP |
| Synonyms | Placenta-specific protein 9, Placenta specific protein 9, placenta 9 |
| Host | Rabbit |
| Reactivity | human, mouse |
| Form | Liquid |
| Formulation | PBS, Azide, Glycerol |
| Applications | WB, IF-P, ELISA |
| Host / Isotype | Rabbit / IgG |
| Tested Applications — Positive WB detected in | human testis tissue |
| Tested Applications — Positive IF-P detected in | mouse testis tissue |
| Recommended Dilutions — Western Blot (WB) | WB : 1:500-1:1000 |
| Recommended Dilutions — Immunofluorescence (IF)-P | IF-P : 1:50-1:500 |
| Positive WB detected in | human testis tissue |
| Positive IF-P detected in | mouse testis tissue |
| Western Blot (WB) | WB : 1:500-1:1000 |
| Immunofluorescence (IF)-P | IF-P : 1:50-1:500 |
| Tested Reactivity | human, mouse |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen | CatNo: Ag12308 Product name: Recombinant human PLAC9 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-97 aa of BC090922 Sequence: MRPLLCALTGLALLRAAGSLAAAEPFSPPRGDSAQSTACDRHMAVQRRLDVMEEMVEKTVDHLGTEVKGLLGLLEELAWNLPPGPFSPAPDLLGDGF Predict reactive species |
| Full Name | placenta-specific 9 |
| Calculated Molecular Weight | 97 aa, 10 kDa |
| Observed Molecular Weight | 8 kDa |
| GenBank Accession Number | BC090922 |
| Gene Symbol | PLAC9 |
| Gene ID (NCBI) | 219348 |
| RRID | AB_2935443 |
| Conjugate | Unconjugated |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | Q5JTB6 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA. |
| IF protocol for PLAC9 antibody 17910-1-AP | Download protocol |
| WB protocol for PLAC9 antibody 17910-1-AP | Download protocol |
| Citations | - |
| Dilutions | WB : 1:500-1:1000 IF-P : 1:50-1:500 |
| Isotype | IgG |
| Clonality | Polyclonal |
| Clone Number | - |
| Conjugation | Unconjugated |
Reviews
Write Your Own Review
Related Products
Check items to add to the cart or
