PLCG1 Recombinant monoclonal antibody, PBS Only (Detector) 84941-2-PBS proteintech
$699.00
In stock
SKU
84941-2-PBS
| Catalog Number | 84941-2-PBS |
| Synonyms | 1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase gamma-1, EC:3.1.4.11, Phosphoinositide phospholipase C-gamma-1, Phospholipase C gamma 1, Phospholipase C II |
| Host | Rabbit |
| Reactivity | human |
| Form | Liquid |
| Formulation | PBS Only |
| Applications | Sandwich ELISA, Indirect ELISA |
| Host / Isotype | Rabbit / IgG |
| Tested Reactivity | human |
| Class | Recombinant |
| Type | Antibody |
| Immunogen | CatNo: Ag27218 Product name: Recombinant human PLCG1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 467-563 aa of Sequence: AEGSAYEEVPTSMMYSENDISNSIKNGILYLEDPVNHEWYPHYFVLTSSKIYYSEETSSDQGNEDEEEPKEVSSSTELHSNEKWFHGKLGAGRDGRH Predict reactive species |
| Full Name | phospholipase C, gamma 1 |
| Calculated Molecular Weight | 149 kDa |
| Gene Symbol | PLCG1 |
| Gene ID (NCBI) | 5335 |
| Conjugate | Unconjugated |
| Purification Method | Protein A purification |
| UNIPROT ID | P19174 |
| Storage Buffer | PBS only, pH 7.3. |
| Storage Conditions | Store at -80°C. |
| Citations | - |
| Isotype | IgG |
| Clonality | Recombinant |
| Clone Number | 242529D6 |
| Conjugation | Unconjugated |
Reviews
Write Your Own Review
Related Products
Check items to add to the cart or
