PLCG2 Polyclonal antibody 27173-1-AP proteintech
$149.00
In stock
SKU
27173-1-AP
| Catalog Number | 27173-1-AP |
| Synonyms | Phospholipase C gamma 2, Phospholipase C IV, PLC gamma 2, PLC IV, PLC γ2, PLCG2, PLCγ2 |
| Host | Rabbit |
| Reactivity | human |
| Form | Liquid |
| Formulation | PBS, Azide, Glycerol |
| Applications | WB, IHC, IF, ELISA |
| Applications | WB, IHC, ELISA |
| Host / Isotype | Rabbit / IgG |
| Tested Applications — Positive WB detected in | Daudi cells, Raji cells, Ramos cells |
| Tested Applications — Positive IHC detected in | human tonsillitis tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
| Recommended Dilutions — Western Blot (WB) | WB : 1:2000-1:8000 |
| Recommended Dilutions — Immunohistochemistry (IHC) | IHC : 1:50-1:500 |
| Positive WB detected in | Daudi cells, Raji cells, Ramos cells |
| Positive IHC detected in | human tonsillitis tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
| Western Blot (WB) | WB : 1:2000-1:8000 |
| Immunohistochemistry (IHC) | IHC : 1:50-1:500 |
| Tested Reactivity | human |
| Cited Reactivity | human |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen | CatNo: Ag25847 Product name: Recombinant human PLCG2 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 826-928 aa of BC007565 Sequence: DISTADFEELEKQIIEDNPLGSLCRGILDLNTYNVVKAPQGKNQKSFVFILEPKQQGYPPVEFATDRVEELFEWFQSIREITWKIDTKENNMKYWEKNQSIAI Predict reactive species |
| Full Name | phospholipase C, gamma 2 (phosphatidylinositol-specific) |
| Calculated Molecular Weight | 148 kDa |
| Observed Molecular Weight | 148 kDa |
| GenBank Accession Number | BC007565 |
| Gene Symbol | PLCG2 |
| Gene ID (NCBI) | 5336 |
| RRID | AB_2880785 |
| Conjugate | Unconjugated |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | P16885 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA. |
| IHC protocol for PLCG2 antibody 27173-1-AP | Download protocol |
| WB protocol for PLCG2 antibody 27173-1-AP | Download protocol |
| human | IF Sci Rep Single-cell transcriptomics reveals cellular evolution underlying pleomorphic adenoma recurrence and malignant transformation. Authors - Yike Li View Article |
| Citations | 1 |
| Dilutions | WB : 1:2000-1:8000 IHC : 1:50-1:500 |
| Isotype | IgG |
| Clonality | Polyclonal |
| Clone Number | - |
| Conjugation | Unconjugated |
Publications
- Single-cell transcriptomics reveals cellular evolution underlying pleomorphic adenoma recurrence and malignant transformation.
Journal: Sci Rep | Authors: Yike Li | Species: human | Application: IF
Reviews
Write Your Own Review
Related Products
Check items to add to the cart or
