CoraLite® Plus 488-conjugated ACTN3 Recombinant monoclonal antibody CL488-84356 proteintech
$479.00
In stock
SKU
CL488-84356
| Catalog Number | CL488-84356 |
| Synonyms | 241168A5, actinin, alpha 3, ACTN 3, Alpha actinin 3, Alpha-actinin skeletal muscle isoform 3 |
| Host | Rabbit |
| Reactivity | human, mouse, rat |
| Form | Liquid |
| Formulation | PBS, Proclin300, BSA, Glycerol |
| Applications | IF-P |
| Host / Isotype | Rabbit / IgG |
| Tested Applications — Positive IF-P detected in | mouse skeletal muscle tissue |
| Recommended Dilutions — Immunofluorescence (IF)-P | IF-P : 1:50-1:500 |
| Positive IF-P detected in | mouse skeletal muscle tissue |
| Immunofluorescence (IF)-P | IF-P : 1:50-1:500 |
| Tested Reactivity | human, mouse, rat |
| Class | Recombinant |
| Type | Antibody |
| Immunogen | CatNo: Ag36709 Product name: Recombinant human ACTN3 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 577-624 aa of BC099647 Sequence: RERGAIMGIQGEIQKICQTYGLRPCSTNPYITLSPQDINTKWDMVRKL Predict reactive species |
| Full Name | actinin, alpha 3 |
| Calculated Molecular Weight | 901 aa, 103 kDa |
| Observed Molecular Weight | 100 kDa |
| GenBank Accession Number | BC099647 |
| Gene Symbol | ACTN3 |
| Gene ID (NCBI) | 89 |
| RRID | AB_3747541 |
| Conjugate | CoraLite® Plus 488 Fluorescent Dye |
| Excitation/Emission Maxima Wavelengths | 493 nm / 522 nm |
| Excitation Laser | Blue laser (488 nm) |
| Purification Method | Protein A purification |
| UNIPROT ID | Q08043 |
| Storage Buffer | PBS with 50% glycerol, 0.05% Proclin300, 0.5% BSA, pH 7.3. |
| Storage Conditions | Store at -20°C. Avoid exposure to light. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. |
| IF protocol for CL Plus 488 ACTN3 antibody CL488-84356 | Download protocol |
| Citations | - |
| Dilutions | IF-P : 1:50-1:500 |
| Isotype | IgG |
| Clonality | Recombinant |
| Clone Number | 241168A5 |
| Conjugation | CoraLite® Plus 488 |
Alpha-actinin-3(ACTN3) is a member of the alpha-actin binding protein gene family. The members of this family are actin cross-linking proteins, among which ACTN2 and ACTN3 are muscle-specific subtypes. ACTN3 is primarily expressed in skeletal muscle and functions as a structural component of the sarcomeric Z line. Protocols Product Specific Protocols IF protocol for CL Plus 488 ACTN3 antibody CL488-84356 Download protocol Standard Protocols Click here to view our Standard Protocols
Product Documents
Reviews
Write Your Own Review
Related Products
Check items to add to the cart or
