PLK2 Recombinant monoclonal antibody, PBS Only 83431-1-PBS proteintech
$699.00
In stock
SKU
83431-1-PBS
| Catalog Number | 83431-1-PBS |
| Synonyms | 230520B2, EC:2.7.11.21, hPlk2, hSNK, PLK 2 |
| Host | Rabbit |
| Reactivity | human |
| Form | Liquid |
| Formulation | PBS Only |
| Applications | IF/ICC, FC (Intra), ELISA |
| Host / Isotype | Rabbit / IgG |
| Tested Reactivity | human |
| Class | Recombinant |
| Type | Antibody |
| Immunogen | CatNo: Ag29837 Product name: Recombinant human PLK2 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 357-497 aa of BC013879 Sequence: SSPAKNFFKKAAAALFGGKKDKARYIDTHNRVSKEDEDIYKLRHDLKKTSITQQPSKHRTDEELQPPTTTVARSGTPAVENKQQIGDAIRMIVRGTLGSCSSSSECLEDSTMGSVADTVARVLRGCLENMPEADCIPKEQL Predict reactive species |
| Full Name | polo-like kinase 2 (Drosophila) |
| Calculated Molecular Weight | 685 aa, 78 kDa |
| GenBank Accession Number | BC013879 |
| Gene Symbol | PLK2 |
| Gene ID (NCBI) | 10769 |
| RRID | AB_3671076 |
| Conjugate | Unconjugated |
| Purification Method | Protein A purfication |
| UNIPROT ID | Q9NYY3 |
| Storage Buffer | PBS only, pH 7.3. |
| Storage Conditions | Store at -80°C. |
| Citations | - |
| Isotype | IgG |
| Clonality | Recombinant |
| Clone Number | 230520B2 |
| Conjugation | Unconjugated |
PLK2(Polo-like kinase 2) is also named as SNK and belongs to the Ser/Thr protein kinase family. It plays a role in normal cell division. Plk2 expression is detected only in G1, and endogenous Plk2 is rapidly turned over. Therefore, the expression of the three mammalian Plks during the cell cycle resembles the successive transition of the cyclins, prompting speculation that Plks may reg-ulate the cell cycle in a manner analogous to that of Cdks(PMID:12972611).
Reviews
Write Your Own Review
Related Products
Check items to add to the cart or
