PMP2 Recombinant monoclonal antibody, PBS Only 85594-5-PBS proteintech
$699.00
In stock
SKU
85594-5-PBS
| Catalog Number | 85594-5-PBS |
| Synonyms | FABP8, M-FABP, Myelin P2 protein |
| Host | Rabbit |
| Reactivity | human, mouse, pig |
| Form | Liquid |
| Formulation | PBS Only |
| Applications | WB, Indirect ELISA |
| Host / Isotype | Rabbit / IgG |
| Tested Reactivity | human, mouse, pig |
| Class | Recombinant |
| Type | Antibody |
| Immunogen | CatNo: Ag3411 Product name: Recombinant human PMP2 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-132 aa of BC034997 Sequence: MSNKFLGTWKLVSSENFDDYMKALGVGLATRKLGNLAKPTVIISKKGDIITIRTESTFKNTEISFKLGQEFEETTADNRKTKSIVTLQRGSLNQVQRWDGKETTIKRKLVNGKMVAECKMKGVVCTRIYEKV Predict reactive species |
| Full Name | peripheral myelin protein 2 |
| Calculated Molecular Weight | 132 aa, 15 kDa |
| Observed Molecular Weight | 15 kDa |
| GenBank Accession Number | BC034997 |
| Gene Symbol | PMP2 |
| Gene ID (NCBI) | 5375 |
| RRID | AB_3744224 |
| Conjugate | Unconjugated |
| Purification Method | Protein A purification |
| UNIPROT ID | P02689 |
| Storage Buffer | PBS only, pH 7.3. |
| Storage Conditions | Store at -80°C. |
| Citations | - |
| Isotype | IgG |
| Clonality | Recombinant |
| Clone Number | 243016D10 |
| Conjugation | Unconjugated |
PMP2 (peripheral myelin protein-2, also known as P2) is one of the major proteins of peripheral myelin and appears to be related to the transport of fatty acids or the metabolism of myelin lipids.P2 constitutes up to 15% of total protein of peripheral nervous system (PNS) myelin. It is also present in small amounts in central nervous system (CNS) myelin, being abundant in spinal cord and brain stem myelin. As a structural protein, P2 is thought to stabilize the myelin membranes.