POLR1D Polyclonal antibody 12254-1-AP proteintech
$149.00
In stock
SKU
12254-1-AP
| Catalog Number | 12254-1-AP |
| Synonyms | AC19, hRPA19, POLR1C, POLR1D, RPA16, RPA9, RPAC2, RPC16, RPO1 3 |
| Host | Rabbit |
| Reactivity | human, mouse, rat |
| Form | Liquid |
| Formulation | PBS, Azide, Glycerol |
| Applications | WB, IP, ELISA |
| Host / Isotype | Rabbit / IgG |
| Tested Applications — Positive WB detected in | HeLa cells, Jurkat cells, mouse lung tissue |
| Tested Applications — Positive IP detected in | HeLa cells |
| Recommended Dilutions — Western Blot (WB) | WB : 1:500-1:2000 |
| Recommended Dilutions — Immunoprecipitation (IP) | IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate |
| Positive WB detected in | HeLa cells, Jurkat cells, mouse lung tissue |
| Positive IP detected in | HeLa cells |
| Western Blot (WB) | WB : 1:500-1:2000 |
| Immunoprecipitation (IP) | IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate |
| Tested Reactivity | human, mouse, rat |
| Cited Reactivity | human |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen | CatNo: Ag2904 Product name: Recombinant human POLR1D protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-122 aa of BC015319 Sequence: MEEDQELERKAIEELLKEAKRGKTRAETMGPMGWMKCPLASTNKRFLINTIKNTLPSHKEQDHEQKEGDKEPAKSQAQKEENPKKHRSHPYKHSFRARGSASYSPPRKRSSQDKYEKRSNRR Predict reactive species |
| Full Name | polymerase (RNA) I polypeptide D, 16kDa |
| Calculated Molecular Weight | 16 kDa |
| Observed Molecular Weight | 20 kDa |
| GenBank Accession Number | BC015319 |
| Gene Symbol | POLR1D |
| Gene ID (NCBI) | 51082 |
| RRID | AB_10640535 |
| Conjugate | Unconjugated |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | P0DPB6 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA. |
| IP protocol for POLR1D antibody 12254-1-AP | Download protocol |
| WB protocol for POLR1D antibody 12254-1-AP | Download protocol |
| human | WB Sci Adv Ribosome changes reprogram translation for chemosurvival in G0 leukemic cells Authors - Chandreyee Datta View Article |
| Citations | 1 |
| Dilutions | WB : 1:500-1:2000 IP : 0.5-4.0 ug for IP and 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate for WB |
| Isotype | IgG |
| Clonality | Polyclonal |
| Clone Number | - |
| Conjugation | Unconjugated |
Publications
- Ribosome changes reprogram translation for chemosurvival in G0 leukemic cells
Journal: Sci Adv | Authors: Chandreyee Datta | Species: human | Application: WB
Reviews
Write Your Own Review
Related Products
Check items to add to the cart or
