POM121 Polyclonal antibody 15645-1-AP proteintech
$149.00
In stock
SKU
15645-1-AP
| Catalog Number | 15645-1-AP |
| Synonyms | KIAA0618, Nuclear envelope pore membrane protein POM 121, Nuclear envelope pore membrane protein POM 121A, Nucleoporin Nup121, NUP121 |
| Host | Rabbit |
| Reactivity | human, mouse, rat |
| Form | Liquid |
| Formulation | PBS, Azide, Glycerol |
| Applications | WB, IHC, IF/ICC, IF-P, ELISA |
| Host / Isotype | Rabbit / IgG |
| Tested Applications — Positive WB detected in | HeLa cells |
| Tested Applications — Positive IHC detected in | human colon tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
| Tested Applications — Positive IF-P detected in | mouse brain tissue |
| Tested Applications — Positive IF/ICC detected in | HCT 116 cells |
| Recommended Dilutions — Western Blot (WB) | WB : 1:1000-1:4000 |
| Recommended Dilutions — Immunohistochemistry (IHC) | IHC : 1:50-1:500 |
| Recommended Dilutions — Immunofluorescence (IF)-P | IF-P : 1:50-1:500 |
| Recommended Dilutions — Immunofluorescence (IF)/ICC | IF/ICC : 1:200-1:800 |
| Positive WB detected in | HeLa cells |
| Positive IHC detected in | human colon tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
| Positive IF-P detected in | mouse brain tissue |
| Positive IF/ICC detected in | HCT 116 cells |
| Western Blot (WB) | WB : 1:1000-1:4000 |
| Immunohistochemistry (IHC) | IHC : 1:50-1:500 |
| Immunofluorescence (IF)-P | IF-P : 1:50-1:500 |
| Immunofluorescence (IF)/ICC | IF/ICC : 1:200-1:800 |
| Tested Reactivity | human, mouse, rat |
| Cited Reactivity | human |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen | CatNo: Ag8177 Product name: Recombinant human POM121 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 635-984 aa of BC008794 Sequence: SQSLHTAVPTATSSSAADFSGFGSTLATSAPATSSQPTLTFSNTSTPTFNIPFGSSAKSPLPSYPGANPQPAFGAAEGQPPGAAKPALAPSFGSSFTFGNSAAPAAAPTPAPPSMIKVVPAYVPTPIHPIFGGATHSAFGLKATASAFGAPASSQPAFGGSTAVFFGAATSSGFGATTQTASSGSSSSVFGSTTPSPFTFGGSAAPAGSGSFGINVATPGSSTTTGAFSFGAGQSGSTATSTPFAGGLGQNALGTTGQSTPFAFNVSSTTESKPVFGGTATPTFGLNTPAPGVGTSGSSLSFGASSAPAQGFVGVAPFGSAALSFSIGAGSKTPGARQRLQARRQHTRKK Predict reactive species |
| Full Name | POM121 membrane glycoprotein (rat) |
| Calculated Molecular Weight | 984 aa, 99 kDa |
| Observed Molecular Weight | 140-150 kDa |
| GenBank Accession Number | BC008794 |
| Gene Symbol | POM121 |
| Gene ID (NCBI) | 9883 |
| RRID | AB_2878160 |
| Conjugate | Unconjugated |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | Q96HA1 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA. |
| IF protocol for POM121 antibody 15645-1-AP | Download protocol |
| IHC protocol for POM121 antibody 15645-1-AP | Download protocol |
| WB protocol for POM121 antibody 15645-1-AP | Download protocol |
| human | IF bioRxiv Altered nuclear envelope homeostasis is a key pathogenic event in C9ORF72-linked ALS/FTD Authors - Riccardo Sirtori View Article |
| bing (Verified Customer) (08-06-2019) | Works great in Western Blot, I use it for Hela and Vero cells lysate, go dilution 1:5000 in 5% milk. Applications: Western Blot, Primary Antibody Dilution: 1:5000 Cell Tissue Type: Hela cells Vero cells |
| Yen-Chen (Verified Customer) (12-03-2018) | Applications: Western Blot, Immunofluorescence, Primary Antibody Dilution: 1:400 for IF, 1:2000 for WB Cell Tissue Type: human neuron |
| Citations | 11 |
| Dilutions | WB : 1:1000-1:4000 IHC : 1:50-1:500 IF-P : 1:50-1:500 IF/ICC : 1:200-1:800 |
| Isotype | IgG |
| Clonality | Polyclonal |
| Clone Number | - |
| Conjugation | Unconjugated |
POM121 is an integral membrane protein that localizes to the central spoke ring complex and participates in anchoring the nuclear pore complex to the nuclear envelope. Catalog#15645-1-AP do well in identifying the nuclear envelope in immunofluorescence experiments. Protocols Product Specific Protocols IF protocol for POM121 antibody 15645-1-AP Download protocol IHC protocol for POM121 antibody 15645-1-AP Download protocol WB protocol for POM121 antibody 15645-1-AP Download protocol Standard Protocols Click here to view our Standard Protocols
Publications
- Heritable transcriptional defects from aberrations of nuclear architecture
Journal: Nature | Authors: Stamatis Papathanasiou | Species: human | Application: IF - Interactions between ALS-linked FUS and nucleoporins are associated with defects in the nucleocytoplasmic transport pathway.
Journal: Nat Neurosci | Authors: Yen-Chen Lin | Species: human | Application: IF - A tubule-sheet continuum model for the mechanism of nuclear envelope assembly
Journal: Dev Cell | Authors: Gengjing Zhao | Species: human | Application: IF - Nuclear pore heterogeneity influences HIV-1 infection and the antiviral activity of MX2.
Journal: Elife | Authors: Melissa Kane | Species: human | Application: WB - POM121 promotes proliferation and metastasis in non-small-cell lung cancer through TGF-β/SMAD and PI3K/AKT pathways
Journal: Cancer Biomark | Authors: Lirong Guan KD Validated | Species: human | Application: WB,IHC - Altered nuclear envelope homeostasis is a key pathogenic event in C9ORF72-linked ALS/FTD
Journal: bioRxiv | Authors: Riccardo Sirtori | Species: human | Application: IF - POM121 induces chemoresistance toward cisplatin in non-small cell lung cancer.
Journal: Cytotechnology | Authors: Jiawen Li | Species: human | Application: WB - POM121 promotes proliferation and metastasis in non-small-cell lung cancer through TGF-β/SMAD and PI3K/AKT pathways
Journal: Cancer Biomark | Authors: Lirong Guan | Species: human | Application: WB,IHC - Altered nuclear envelope homeostasis is a key pathogenic event in C9ORF72-linked ALS/FTD
Journal: bioRxiv | Authors: Riccardo Sirtori | Species: human | Application: IF - Investigating Nuclear Envelope Assembly on Mis-Segregated Chromosomes.
Journal: Methods Mol Biol | Authors: Shiwei Liu | Species: human | Application: IF - Nuclear pore heterogeneity influences HIV-1 infection and the antiviral activity of MX2.
Journal: Elife | Authors: Melissa Kane | Species: human | Application: WB - An ER-associated structure sequesters misassembled FG-rich nucleoporins to help maintain nuclear pore complex function.
Journal: J Cell Sci | Authors: Madison Pletan | Species: monkey | Application: IF
Reviews
Write Your Own Review
Related Products
Check items to add to the cart or
