PPAPDC3 Polyclonal antibody 20635-1-AP proteintech
$149.00
In stock
SKU
20635-1-AP
| Catalog Number | 20635-1-AP |
| Synonyms | C9orf67, KIAA0515, NET39, PPAPDC3 |
| Host | Rabbit |
| Reactivity | human, mouse, rat |
| Form | Liquid |
| Formulation | PBS, Azide, Glycerol |
| Applications | WB, IP, ELISA |
| Host / Isotype | Rabbit / IgG |
| Tested Applications — Positive WB detected in | mouse skeletal muscle tissue |
| Tested Applications — Positive IP detected in | mouse skeletal muscle tissue |
| Recommended Dilutions — Western Blot (WB) | WB : 1:500-1:1000 |
| Recommended Dilutions — Immunoprecipitation (IP) | IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate |
| Positive WB detected in | mouse skeletal muscle tissue |
| Positive IP detected in | mouse skeletal muscle tissue |
| Western Blot (WB) | WB : 1:500-1:1000 |
| Immunoprecipitation (IP) | IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate |
| Tested Reactivity | human, mouse, rat |
| Cited Reactivity | human |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen | CatNo: Ag14676 Product name: Recombinant human PPAPDC3 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-65 aa of BC006362 Sequence: MPASQSRARARDRNNVLNRAEFLSLNQPPKGGPEPRSSGRKASGPSAQPPPAGDGARERRQSQQL Predict reactive species |
| Full Name | phosphatidic acid phosphatase type 2 domain containing 3 |
| Calculated Molecular Weight | 271 aa, 29 kDa |
| Observed Molecular Weight | 29 kDa |
| GenBank Accession Number | BC006362 |
| Gene Symbol | PPAPDC3 |
| Gene ID (NCBI) | 84814 |
| RRID | AB_10696180 |
| Conjugate | Unconjugated |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | Q8NBV4 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA. |
| IP protocol for PPAPDC3 antibody 20635-1-AP | Download protocol |
| WB protocol for PPAPDC3 antibody 20635-1-AP | Download protocol |
| human | WB Front Cell Dev Biol Nuclear envelope transmembrane proteins involved in genome organization are misregulated in myotonic dystrophy type 1 muscle Authors - Vanessa Todorow View Article |
| Citations | 3 |
| Dilutions | WB : 1:500-1:1000 IP : 0.5-4.0 ug for IP and 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate for WB |
| Isotype | IgG |
| Clonality | Polyclonal |
| Clone Number | - |
| Conjugation | Unconjugated |
PPAPDC3(Phosphatidic acid phosphatase type 2 domain-containing protein 3) is also named as C9orf67 and belongs to the PA-phosphatase related phosphoesterase family. It plays a role as negative regulator of myoblast differentiation, in part through effects on MTOR signaling. Protocols Product Specific Protocols IP protocol for PPAPDC3 antibody 20635-1-AP Download protocol WB protocol for PPAPDC3 antibody 20635-1-AP Download protocol Standard Protocols Click here to view our Standard Protocols
Publications
- Specific nuclear envelope transmembrane proteins can promote the location of chromosomes to and from the nuclear periphery.
Journal: Genome Biol | Authors: Zuleger Nikolaj N | Species: human | Application: WB - Lamin A/C Assembly Defects in LMNA-Congenital Muscular Dystrophy Is Responsible for the Increased Severity of the Disease Compared with Emery-Dreifuss Muscular Dystrophy.
Journal: Cells | Authors: Anne T Bertrand | Species: human | Application: WB - Nuclear envelope transmembrane proteins involved in genome organization are misregulated in myotonic dystrophy type 1 muscle
Journal: Front Cell Dev Biol | Authors: Vanessa Todorow | Species: human | Application: WB
Reviews
Write Your Own Review
Related Products
Check items to add to the cart or
